DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and Prmt1

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_006229206.1 Gene:Prmt1 / 60421 RGDID:62020 Length:371 Species:Rattus norvegicus


Alignment Length:104 Identity:23/104 - (22%)
Similarity:39/104 - (37%) Gaps:31/104 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 WFSEIDSFGDKCARVLRDLYVPQAIKTPPGELGIPDCEATSLYKADPKRYKPRN------RIYTS 315
            |:..:..|...|   ::|:    |||.|..::            .|||:.....      .|||.
  Rat   215 WWENVYGFDMSC---IKDV----AIKEPLVDV------------VDPKQLVTNACLIKEVDIYTV 260

  Fly   316 QLELEAALSKLSSLQLQFNSDSEHTYGQQLIDWEQIEPT 354
            ::| :...:....||::.|.     |...|:.:..||.|
  Rat   261 KVE-DLTFTSPFCLQVKRND-----YVHALVAYFNIEFT 293

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity