DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and TRMT9B

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_011542898.1 Gene:TRMT9B / 57604 HGNCID:26725 Length:539 Species:Homo sapiens


Alignment Length:92 Identity:24/92 - (26%)
Similarity:36/92 - (39%) Gaps:30/92 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 RNRIYTSQLELEAALSKLSSLQLQFNSDSEHTYGQQLIDWEQIEP--THAKSSALPKERLERKRQ 371
            |.|::...::.|||       ||    :.:|.:..    :|...|  :..:|.|.|     |.||
Human    78 RARVWPPGMDHEAA-------QL----EKQHVHNV----YESTAPYFSDLQSKAWP-----RVRQ 122

  Fly   372 QLENLANAVVSLAQPGDRIVDFCSGTG 398
            .|:.        .:||..|.|...|||
Human   123 FLQE--------QKPGSLIADIGCGTG 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286
AdoMet_MTases 368..486 CDD:302624 11/31 (35%)
TRMT9BXP_011542898.1 AdoMet_MTases 86..>224 CDD:302624 22/84 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.