DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and alkbh8

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_009290865.1 Gene:alkbh8 / 556362 ZFINID:ZDB-GENE-100922-251 Length:666 Species:Danio rerio


Alignment Length:156 Identity:34/156 - (21%)
Similarity:56/156 - (35%) Gaps:60/156 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LEIEISTQKETTIYTGVSSFLALFTYKFLKDPKNVRVNFVSTKIEGGKIALRSSQ---LKKELTD 67
            :|.|.:.||.                |:||:..:      .:..|||: .|::.:   ::||..|
Zfish   503 MEQEYNNQKS----------------KYLKEEAS------GSSREGGE-ELKTEENKAIQKEEHD 544

  Fly    68 RH----ITCRD----AASLPAI-----------QDLKLPIYEKDGNTFIAGTCAVCRELIARQPN 113
            |:    |.|.|    ..:.|.|           |||.:|.:.|.......|..:.|.::......
Zfish   545 RNMISDIRCTDDGLSNVTQPKIHVHTNRTAFLSQDLLVPWHLKGNMENKKGAASGCADIPVENAK 609

  Fly   114 E--------------ELKKL-LGFKG 124
            :              ||::| ||.||
Zfish   610 QKPVFHRYYHVFQQGELEELCLGVKG 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286
AdoMet_MTases 368..486 CDD:302624
alkbh8XP_009290865.1 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 130..300 CDD:304390
Methyltransf_11 409..498 CDD:285453
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.