DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and prmt3

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001017655.1 Gene:prmt3 / 550348 ZFINID:ZDB-GENE-041105-1 Length:512 Species:Danio rerio


Alignment Length:78 Identity:13/78 - (16%)
Similarity:30/78 - (38%) Gaps:19/78 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   519 ADQAHEMGTTNCKPETTLQGLHC-------------------MSVVDTDRLLQAEEAGYQVILTR 564
            :|:............||||.|.|                   :.::|..:..:.::.||..::..
Zfish    20 SDEEQWQSMEEVSEHTTLQCLFCDRNLTSVSETFQHCKADHGVDILDLVQKHKLDDYGYIKMINY 84

  Fly   565 LKPEQCTPKNHLL 577
            ::..:|:.::.||
Zfish    85 IRTTKCSAESLLL 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286
AdoMet_MTases 368..486 CDD:302624
prmt3NP_001017655.1 zf-C2H2_2 39..>86 CDD:289522 5/46 (11%)
Methyltransf_18 236..340 CDD:289607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.