DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and Atpsckmt

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001102648.1 Gene:Atpsckmt / 499561 RGDID:1560629 Length:216 Species:Rattus norvegicus


Alignment Length:183 Identity:36/183 - (19%)
Similarity:59/183 - (32%) Gaps:77/183 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PAIQDLKLPIYEKDGNTFIAGTCAVCRELIARQPNEELKKLLGFK-----------GSCLLAPSE 132
            ||::.:.||        |:..|        :||. |.:.|:|..:           |..::|.::
  Rat    56 PALRKVCLP--------FVPAT--------SRQV-ENVVKMLQHRRGPLVDIGSGDGRIVIAAAK 103

  Fly   133 AS------------IW--------------TKFCEVDLVAVVSKLHSGQVLEFVPQEVVRFEQHM 171
            |.            :|              .||...||..|....:|..|:..|||.:.:.|:.:
  Rat   104 AGFPAVGYELNPWLVWYSRYRAWREGVHGSAKFYISDLWKVTFAQYSNVVIFGVPQMMPQLEKKL 168

  Fly   172 NEPVRMHNIYKQAREQANQTENGGKVKRRERVQIKCTTPKEELLIEHRFAEGI 224
            .                .:.|:|.:|       |.|..|......:|...|||
  Rat   169 E----------------FELEDGARV-------IACRFPFPHWTPDHTTGEGI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286 4/13 (31%)
AdoMet_MTases 368..486 CDD:302624
AtpsckmtNP_001102648.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Required for mitochondrial location. /evidence=ECO:0000250|UniProtKB:Q6P4H8 51..85 11/45 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.