DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and Art6

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster


Alignment Length:156 Identity:34/156 - (21%)
Similarity:50/156 - (32%) Gaps:55/156 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 HSGQVLEFVP-------QEVVRFEQHMN---EPVRMHNIYKQAREQANQTENGGKVKRRERVQIK 206
            ::.|.|.|:.       |...|.|.|||   :.|||     ||...| ..::||..:.:..:.:.
  Fly     4 NANQKLPFLEGKDSDYFQSYSRLETHMNMLRDSVRM-----QAFRDA-IVQDGGLFQDKIVLDVG 62

  Fly   207 CTTPKEELLIEHRFA--EGISFTIADIILYPLLRIVFQHCGQMLPHFPLTSTWFSEIDSFGDKCA 269
            |.|.     |...||  .|.|..||                             .|.....|...
  Fly    63 CGTG-----ILSLFAAEAGASKVIA-----------------------------VECTDIADIAE 93

  Fly   270 RVLRDLYVPQAIKTPPG---ELGIPD 292
            .::||......:|...|   ::.:||
  Fly    94 EIIRDNQKENVVKVVKGLVEQVELPD 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286 7/47 (15%)
AdoMet_MTases 368..486 CDD:302624
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 28/131 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.