DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and CG10903

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001262365.1 Gene:CG10903 / 40952 FlyBaseID:FBgn0037543 Length:276 Species:Drosophila melanogaster


Alignment Length:288 Identity:65/288 - (22%)
Similarity:89/288 - (30%) Gaps:118/288 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 PGELGIPDCEATSLYKADPKRYKPRNRIYTSQLEL-EAALSKL-----------------SSLQL 331
            |.|:...|.||        |:|....||...|:|: |.||..|                 |.|..
  Fly    10 PPEIFYNDDEA--------KKYSTNTRIIEIQVEMAERALELLALPDDDESRLILDIGCGSGLSG 66

  Fly   332 QFNSDSEHTYGQQLIDWEQIEPTHAKSSALPKERLERKRQQLENLANAVVSLAQPGDRIVDFCSG 396
            ....||||.       |..|:    .|.::....:||:      :|..|: |...|:. :.|..|
  Fly    67 SVLEDSEHM-------WIGID----ISKSMLDIAVERE------VAGDVI-LGDMGEG-MPFKPG 112

  Fly   397 TGHLAILLALKLPNCTIIVMENKAFSLLQAQKRSNELGLTNCVFYQCNIDYFVGG-----FKIGA 456
            |...||                 :.|.||               :.||.|.....     .|...
  Fly   113 TFDGAI-----------------SISALQ---------------WLCNADKSYHNPHKRLLKFFT 145

  Fly   457 SLHACGTAT-------------DIVLQQCRRAKAHFVCCPCCYGSLQPMPHISYPLS---KAFQK 505
            :|.:|.|.|             .|.:...:..||.|      ||.|.    :.||.|   |.:..
  Fly   146 TLFSCLTRTARAVFQFYPENSDQIEMVTSQAMKAGF------YGGLV----VDYPNSAKAKKYYL 200

  Fly   506 VLDTKDYLYIAHSADQAHEMGTTNCKPE 533
            ||.|      ..||:....:|:    ||
  Fly   201 VLMT------GGSAELPQALGS----PE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286
AdoMet_MTases 368..486 CDD:302624 25/135 (19%)
CG10903NP_001262365.1 Methyltransf_11 56..142 CDD:285453 26/136 (19%)
WBS_methylT 202..272 CDD:289366 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.