DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and Mettl7a2

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_955771.2 Gene:Mettl7a2 / 393082 MGIID:3026615 Length:244 Species:Mus musculus


Alignment Length:253 Identity:50/253 - (19%)
Similarity:77/253 - (30%) Gaps:81/253 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 IILYPLLRI--------VFQHC-GQMLPHFPLTSTWFSEIDSFGDKCARVLRDLYVP-QAIKTPP 285
            |:.:|:..:        |.:.| ...|..|.:...|         |.|.:.|:|:.. |....|.
Mouse    14 IVAFPMFLLNLLGMWSWVCKKCFPYFLKRFAMIYNW---------KMASLKRELFSNLQEFAGPS 69

  Fly   286 GELGI---------------PDCEATSLYKADPKRYKPRNRIYTSQLELEAALSKLSSLQLQFN- 334
            |:|.:               |.|..|.:   ||          ....|.....|...:.||||. 
Mouse    70 GKLTLLEVGCGTGANFKFYPPGCRVTCI---DP----------NPNFEKFLFKSVAENRQLQFER 121

  Fly   335 -----SDSEHTYGQQLIDWEQIEPTHAKSSALPKERLERKRQQLENLANAVVSLAQPG------D 388
                 .:..|......:|  .:..|....|...:|::.|:          |..:.:||      |
Mouse   122 FVVAAGEDMHQVTDGSVD--VVVCTLVLCSVKNQEKILRE----------VCRVLKPGGAFYFID 174

  Fly   389 RIVDFCSGTGH-----LAILLALKLPNCTII-----VMENKAFSLLQAQKRSNELGLT 436
            .:.|..|...:     ||.:..|....|.:.     .:|...||.|..|.....|.||
Mouse   175 HVADERSTWNYFWQQVLARVWFLAFDGCNLTRESWKAIEQANFSKLNLQHIQAPLPLT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286 6/35 (17%)
AdoMet_MTases 368..486 CDD:302624 19/85 (22%)
Mettl7a2NP_955771.2 SmtA 70..>200 CDD:223574 28/154 (18%)
Methyltransf_11 75..172 CDD:285453 20/121 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.