DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and CG17807

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster


Alignment Length:256 Identity:44/256 - (17%)
Similarity:85/256 - (33%) Gaps:88/256 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PKNVRV-----NFVSTKIEGGKIALRSSQLKKELTDRHITCRDAASLPAI---QDLKLP------ 87
            ||::.|     ..::|:..|.:.:|...:|:|...|        .|.||:   |..|:|      
  Fly   295 PKHIDVVPSASGGLTTQARGKRTSLTFRRLRKGPCD--------CSYPALCDTQQTKVPQELHAS 351

  Fly    88 ---------------IYEKDGNTFIA-----------------------------GTCAVCRELI 108
                           :|:|..:.|..                             |....|..|:
  Fly   352 LAAQAITLEQQNVHEVYDKIADHFSETRHTPWPQVSEFLDSFEPQSVVLDIGCGNGKYLSCNPLL 416

  Fly   109 ARQPNEELKKLLG---------FKGSCLLAPSEASIWTKFCEVD---LVAVVSKLHSGQVLEFVP 161
            .....:..:.||.         |:..||:.|..:|      .:|   .:||:..|.:.:......
  Fly   417 LSVGCDRAQGLLAVGRRKGQNVFRCDCLVVPVRSS------SIDGCISIAVIHHLATKERRLAAL 475

  Fly   162 QEVVRFEQHMNEPVRMHNIYKQAREQANQTENGGKVKRRERVQIKCTTPKEELLIEHRFAE 222
            ||:.|    :..|.....:|..|::|....:....:::.:.|..:.||.:::...:|:..|
  Fly   476 QEMAR----VLRPGGRALVYVWAKDQRKNDKKSTYLRQNKAVNKERTTEQQQRQKQHQELE 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286 2/11 (18%)
AdoMet_MTases 368..486 CDD:302624
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390 6/26 (23%)
Methyltransf_11 400..490 CDD:285453 18/99 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.