DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and Prmt9

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001178528.1 Gene:Prmt9 / 291947 RGDID:1306157 Length:841 Species:Rattus norvegicus


Alignment Length:283 Identity:61/283 - (21%)
Similarity:109/283 - (38%) Gaps:72/283 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EGGKIALRS--SQLKKELTDRHIT--CRD----AASLPAIQDLKLPIYEKDGN------TFIAGT 100
            ||.:.|:|.  |.|..|...:.:.  |:|    ..|.|:..|   |.|..|.:      ..:|||
  Rat   535 EGFRTAMRKVLSSLAPETPSQPMEAHCQDMETNLESAPSTSD---PFYVLDVSEGFSLLPILAGT 596

  Fly   101 CAVCRELIARQPNEELKKLLGFKGSCLLAP--SEAS--------IWTKFCEVDLVAVVSKLHSGQ 155
                  |...||...::|    ...|:...  |||:        .|.:..| |..||:.:..|.:
  Rat   597 ------LGQVQPYSSVEK----DQHCIALDLISEANHFPKETLEFWLRHIE-DEAAVLQRPKSDK 650

  Fly   156 VLEFVPQEVVRFEQHMNEPVRMHNIYKQAREQANQT----ENGGKVKRRERVQIKCTTPKEELLI 216
            :...:..:|:       ||..:  |.::..|:|..:    ::|||: ..:.|.:.....:.:.|:
  Rat   651 LWSIIILDVI-------EPSGL--IQQEIMEKAAISRCLLQSGGKI-FPQYVLMFGMLVESQTLV 705

  Fly   217 EHRFAEGISFTIADIILYPLL---RIVFQHCGQM--LPHFPLTSTWFSEIDSFGDKCARVLR-DL 275
            |....:|...|:. :.:.|.:   ::..:.|..:  ||..||:..            ..:|| ||
  Rat   706 EESAVQGTEHTLG-LNIAPFINQFQVPIRVCLDLSSLPCIPLSQP------------VELLRLDL 757

  Fly   276 YVPQAIKTPPGELGIPDCEATSL 298
            ..|. :.|...|:.:..|.:..|
  Rat   758 MTPY-LNTSNREVKVRVCRSGRL 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286 10/50 (20%)
AdoMet_MTases 368..486 CDD:302624
Prmt9NP_001178528.1 TPR_11 68..132 CDD:290150
TPR repeat 68..95 CDD:276809
TPR repeat 100..130 CDD:276809
AdoMet_MTases 148..>338 CDD:302624
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.