DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and Prmt7

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_663379.1 Gene:Prmt7 / 214572 MGIID:2384879 Length:692 Species:Mus musculus


Alignment Length:190 Identity:38/190 - (20%)
Similarity:69/190 - (36%) Gaps:45/190 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ISTQKETTIYTGVSSF---LALFTYKFLKDPKNVRVN-----FVSTKIEGGKIAL-------RSS 59
            :..::..|:.:.|:|:   ..:|....|:|..:| :|     ..:..:||.|::|       .:|
Mouse   421 LGAEQVFTVESSVASYRLMKRIFKVNHLEDKISV-INKRPELLTAADLEGKKVSLLLGEPFFTTS 484

  Fly    60 QLK---------KELTDRHITCRDAASLPAIQDLKLPIYEKDGNTFIAGTCAVCRELIARQPNEE 115
            .|.         :...|:|: ...|..:|....|...|.|......|...|..|........::.
Mouse   485 LLPWHNLYFWYVRTSVDQHL-APGAVVMPQAASLHAVIVEFRDLWRIRSPCGDCEGFDVHIMDDM 548

  Fly   116 LKKLLGFKGSCLLAPSEASIWTKFCEVDLVAVVSKLHSGQVLEFVPQEVVRFEQHMNEPV 175
            :|..|.|:.|....|.  .:|...|.     .:||          |||::.|:  ..:|:
Mouse   549 IKHSLDFRESREAEPH--PLWEYPCR-----SLSK----------PQEILTFD--FQQPI 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286
AdoMet_MTases 368..486 CDD:302624
Prmt7NP_663379.1 AdoMet_MTases 37..>186 CDD:418430
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.