Sequence 1: | NP_609918.1 | Gene: | CG10428 / 35150 | FlyBaseID: | FBgn0032724 | Length: | 585 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_504045.1 | Gene: | R08E5.3 / 178795 | WormBaseID: | WBGene00019963 | Length: | 365 | Species: | Caenorhabditis elegans |
Alignment Length: | 246 | Identity: | 51/246 - (20%) |
---|---|---|---|
Similarity: | 85/246 - (34%) | Gaps: | 67/246 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 318 ELEAALSKLSSLQLQFNSDSEHTYGQQLIDWEQIEPTHAKSSALPKERLERKRQQLENLANAVV- 381
Fly 382 SLAQPGDRIVDFCSGTGHLAILLALKLPNCTIIVMENKAFSLLQAQKRSNELG--LTNCVFYQCN 444
Fly 445 I----DYFVGGFKIGASLHAC--GTATDIVLQQCRRA---------------------KA----- 477
Fly 478 --------HFVC------CP--CCYGSLQPMPHISYPLSK-AFQ--KVLDT 509 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10428 | NP_609918.1 | GST_C_family | <212..258 | CDD:198286 | |
AdoMet_MTases | 368..486 | CDD:302624 | 32/168 (19%) | ||
R08E5.3 | NP_504045.1 | Methyltransf_31 | 175..>283 | CDD:316372 | 22/107 (21%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |