DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and F49C12.10

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_501633.1 Gene:F49C12.10 / 177754 WormBaseID:WBGene00009879 Length:275 Species:Caenorhabditis elegans


Alignment Length:243 Identity:52/243 - (21%)
Similarity:82/243 - (33%) Gaps:59/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 ILYPLLRIVFQHCG---QMLPHFPLTSTWFSEIDSFGDKCARVLRDLYVPQAIKTPPGELGIPDC 293
            |:|||:|||....|   ..|.::|.::..::::..|       :.||          |:|...:.
 Worm    23 IMYPLMRIVAPKLGVRFMNLGYWPSSAPQYAKMRMF-------MEDL----------GDLDEYES 70

  Fly   294 EATSLYKADPKRYKPRNRIYTSQLE-LEAALSKLSSLQLQFNSDSEHTYGQQLIDWEQIEPTHAK 357
            :...:|..:.......|..|..|.| ||.:..:..||                 ||  ||..|..
 Worm    71 DRAHIYLYEKALSMHPNYPYFEQFEILEVSCGQGYSL-----------------DW--IEKWHGP 116

  Fly   358 SSALPKERLERKRQQLENLANAVV--SLAQP-GDRIVDFCSG--TGHLAILLALKLPNCTIIVME 417
            :..:    :...:....|:.|.|.  :|..| .|...||...  ..||.....|.....:.::..
 Worm   117 TKCI----IGCDKVVTRNMNNIVYGDALDLPFADNSFDFVLNVEAAHLYSDYKLFFKEGSRVLRS 177

  Fly   418 NKAFSLL---------QAQKRSNELGLTNCVFYQCNIDYFVGGFKIGA 456
            ..||..:         |.|:.:...|.....|..|. |..|.|.|..|
 Worm   178 GGAFCYMDIRYPHEAKQIQETATAAGFVKKHFEFCT-DEVVEGLKYSA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286 10/28 (36%)
AdoMet_MTases 368..486 CDD:302624 23/103 (22%)
F49C12.10NP_501633.1 Methyltransf_11 97..182 CDD:369777 21/107 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.