Sequence 1: | NP_609918.1 | Gene: | CG10428 / 35150 | FlyBaseID: | FBgn0032724 | Length: | 585 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_954584.2 | Gene: | ATPSCKMT / 134145 | HGNCID: | 27029 | Length: | 233 | Species: | Homo sapiens |
Alignment Length: | 234 | Identity: | 47/234 - (20%) |
---|---|---|---|
Similarity: | 70/234 - (29%) | Gaps: | 94/234 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 GGKIALRSSQLKKELTDRHITCRDAASLPAIQDLKLPIYEKD----------GNTFIA------- 98
Fly 99 ----GTCAVCRELI---ARQPNEELKKLLGFKGSCL------------------------LAP-- 130
Fly 131 ---SEASIW-------TKFCEVDLVAVVSKLHSGQVLEFVPQEVVRFEQHMNEPVRMHNIYKQAR 185
Fly 186 EQANQTENGGKVKRRERVQIKCTTPKEELLIEHRFAEGI 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10428 | NP_609918.1 | GST_C_family | <212..258 | CDD:198286 | 4/13 (31%) |
AdoMet_MTases | 368..486 | CDD:302624 | |||
ATPSCKMT | NP_954584.2 | Required for mitochondrial location. /evidence=ECO:0000269|PubMed:30530489 | 56..90 | 5/33 (15%) | |
AdoMet_MTases | 83..>188 | CDD:388410 | 23/127 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |