DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and BUD23

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_006715910.1 Gene:BUD23 / 114049 HGNCID:16405 Length:304 Species:Homo sapiens


Alignment Length:158 Identity:31/158 - (19%)
Similarity:47/158 - (29%) Gaps:66/158 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 QAIKTPPGELGIPDCEATS----LYKADPKRYKPRNRIYTSQLELEAALSKLSSLQLQ-FNSDSE 338
            |.|...||.  ...|.:.|    |..|:.|...|..|:|.....|.:.|.:.|...|| :..:||
Human   130 QGIPFKPGT--FDGCISISAVQWLCNANKKSENPAKRLYCFFASLFSVLVRGSRAVLQLYPENSE 192

  Fly   339 HT------------YGQQLIDW-----------------------------EQIEPTHA------ 356
            ..            .|..::|:                             :::||..:      
Human   193 QLELITTQATKAGFSGGMVVDYPNSAKAKKFYLCLFSGPSTFIPEGLSENQDEVEPRESVFTNER 257

  Fly   357 ------------KSSALPKERLERKRQQ 372
                        ||.|...|:.||.|:|
Human   258 FPLRMSRRGMVRKSRAWVLEKKERHRRQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286
AdoMet_MTases 368..486 CDD:302624 3/5 (60%)
BUD23XP_006715910.1 AdoMet_MTases 38..>117 CDD:302624
Methyltransf_11 81..184 CDD:285453 15/55 (27%)
WBS_methylT 227..302 CDD:289366 10/59 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.