DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and CARM1

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_954592.1 Gene:CARM1 / 10498 HGNCID:23393 Length:608 Species:Homo sapiens


Alignment Length:312 Identity:62/312 - (19%)
Similarity:97/312 - (31%) Gaps:85/312 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 EVVRFEQHMNEPVRMHNIYKQAREQANQTENGGKVKRRERVQIKCTTPKEELLIEHRFAE----- 222
            |.....||....|:.:|:..:......:.|   :|...|:|.|..:.|...:|...|..|     
Human   214 EASTMAQHAEVLVKSNNLTDRIVVIPGKVE---EVSLPEQVDIIISEPMGYMLFNERMLESYLHA 275

  Fly   223 -------GISF-TIADIILYPLLRIVFQHCGQMLPHFPLTSTWFSEIDSFGDKCARVLRDLYVPQ 279
                   |..| ||.|:.|.|     |......:..|...:.|:.  .||.......||...|.:
Human   276 KKYLKPSGNMFPTIGDVHLAP-----FTDEQLYMEQFTKANFWYQ--PSFHGVDLSALRGAAVDE 333

  Fly   280 AIKTPPGELGIPDCEATSLYKADPKRYKPRNRIYTSQLELEAALSKLSSLQLQFNSDSEHT---- 340
            ..:.|     :.|.....:..|...:|...        .|||....|..:::.|.....|:    
Human   334 YFRQP-----VVDTFDIRILMAKSVKYTVN--------FLEAKEGDLHRIEIPFKFHMLHSGLVH 385

  Fly   341 ----------YGQQLIDWEQIEPTHAKSSALPKERLERKRQQLENLANAVVSLAQPGDRIVDFCS 395
                      .|..:..|....||.      |.....:.|...::     ...|:.||.:    |
Human   386 GLAFWFDVAFIGSIMTVWLSTAPTE------PLTHWYQVRCLFQS-----PLFAKAGDTL----S 435

  Fly   396 GTGHLAILLALKLPNCTIIVMENKAFSL-LQAQ------KRSNELGLTNCVF 440
            ||             |.:|..:.:::.: :.||      |.||.|.|.|..|
Human   436 GT-------------CLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFF 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286 12/58 (21%)
AdoMet_MTases 368..486 CDD:302624 18/80 (23%)
CARM1NP_954592.1 CARM1 34..138 CDD:288395
PRMT5 <172..435 CDD:282971 48/258 (19%)
Methyltransf_18 184..283 CDD:289607 14/71 (20%)
Transactivation domain. /evidence=ECO:0000250 499..608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.