DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10602 and Enpep

DIOPT Version :10

Sequence 1:NP_609916.5 Gene:CG10602 / 35146 FlyBaseID:FBgn0032721 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_031960.1 Gene:Enpep / 13809 MGIID:106645 Length:945 Species:Mus musculus


Alignment Length:94 Identity:27/94 - (28%)
Similarity:37/94 - (39%) Gaps:21/94 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DGGTPGNDLTRQAAINVSNGITSGVLTGVV--PLQTG--ILPNIVNTGTPTG------------- 83
            |.|:.|....:|||:.|...|...|:...|  |.:||  .|.|.: .|..||             
Mouse     9 DTGSDGKLCVQQAALQVLQQIQQPVVVVAVVGPYRTGKSFLMNRL-AGKRTGFALSSNIKPKTEG 72

  Fly    84 --QTCVCVPTGRCNTTSTGGTTDGAGQLD 110
              ..||..|| :..||.....|:|.|.::
Mouse    73 IWMWCVPHPT-KAGTTLVLLDTEGLGDVE 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10602NP_609916.5 Ribosomal_L13 15..>50 CDD:459856 5/13 (38%)
leuko_A4_hydro 79..681 CDD:274120 12/47 (26%)
EnpepNP_031960.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..77 7/34 (21%)
M1_APN-Q_like 92..531 CDD:341064 3/9 (33%)
ERAP1_C 607..925 CDD:463368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.