DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL13 and MRPL23

DIOPT Version :9

Sequence 1:NP_523598.2 Gene:mRpL13 / 35145 FlyBaseID:FBgn0032720 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_014793.1 Gene:MRPL23 / 854321 SGDID:S000005676 Length:163 Species:Saccharomyces cerevisiae


Alignment Length:155 Identity:50/155 - (32%)
Similarity:79/155 - (50%) Gaps:9/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FARTWHIYDCTWQNPF--ESAKLVKTHLLGLQKPIYHPMNDCGDHVVLINTREIALPGDEWVKRV 75
            |||.||..|.......  ..|..:...|:|..||:|||..||||:||:.|.::|.:.|.::.::.
Yeast    12 FARLWHHVDVARDKRTLGRLASAIAITLIGRHKPVYHPSQDCGDYVVVTNCQKIRVTGKKFEQKT 76

  Fly    76 YFHHTGYPGGAS-WTLAWQLHEKDPTMVMKKAVYNSMRGNLQRRHTMQRLHLFADDQVPEEILQN 139
            |:.|:|.||... .|:...:.:|....::||||...:..|..|:..:.||.:|...:.|.:  ||
Yeast    77 YWSHSGRPGQLKLQTMNKVVADKGFGEILKKAVSGMLPKNKLRKQRLDRLKVFDGSENPYK--QN 139

  Fly   140 VTNQIRTPRSIPQRLDHIDKETLEN 164
            :|.......|||:.|    ||::.|
Yeast   140 ITAFAHEQSSIPEPL----KESIFN 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL13NP_523598.2 Ribosomal_L13 16..141 CDD:278969 39/127 (31%)
MRPL23NP_014793.1 rplM_bact 4..147 CDD:162186 43/136 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I2368
eggNOG 1 0.900 - - E1_COG0102
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90894
Inparanoid 1 1.050 78 1.000 Inparanoid score I1638
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62551
OrthoFinder 1 1.000 - - FOG0003171
OrthoInspector 1 1.000 - - oto99521
orthoMCL 1 0.900 - - OOG6_101118
Panther 1 1.100 - - LDO PTHR11545
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4169
SonicParanoid 1 1.000 - - X3602
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.