DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL13 and emb1473

DIOPT Version :9

Sequence 1:NP_523598.2 Gene:mRpL13 / 35145 FlyBaseID:FBgn0032720 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_177984.1 Gene:emb1473 / 844199 AraportID:AT1G78630 Length:241 Species:Arabidopsis thaliana


Alignment Length:138 Identity:35/138 - (25%)
Similarity:62/138 - (44%) Gaps:8/138 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RTWHIYDCTWQNPFESAKLVKTHLLGLQKPIYHPMNDCGDHVVLINTREIALPGDEWVKRVYFHH 79
            :.|.:.|.|.:.....|..:..|:.|.....|.|..|.|..|:::|..::|:.|.:..:::|..|
plant   103 KPWFVVDATDKILGRLASTIANHIRGKNLASYTPSVDMGAFVIVVNAEKVAVSGKKRNQKLYRRH 167

  Fly    80 TGYPGGASWTLAWQLHEKDPTMVMKKAVYNSMRGNLQR----RHTMQRLHLFADDQVPEEILQNV 140
            :|.|||.:.....||.::.|..:::.||    ||.|.:    |.....|.::.....|.|..:.:
plant   168 SGRPGGMTVETFDQLQQRIPERIVEHAV----RGMLPKGRLGRALFNHLKVYKGPDHPHEAQKPL 228

  Fly   141 TNQIRTPR 148
            ...||..|
plant   229 DLPIRDKR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL13NP_523598.2 Ribosomal_L13 16..141 CDD:278969 32/128 (25%)
emb1473NP_177984.1 rplM 88..234 CDD:181703 33/134 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I3767
eggNOG 1 0.900 - - E1_COG0102
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H90894
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1119705at2759
OrthoFinder 1 1.000 - - FOG0003171
OrthoInspector 1 1.000 - - otm3247
orthoMCL 1 0.900 - - OOG6_101118
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.680

Return to query results.
Submit another query.