DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL13 and AT3G01790

DIOPT Version :9

Sequence 1:NP_523598.2 Gene:mRpL13 / 35145 FlyBaseID:FBgn0032720 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_186828.2 Gene:AT3G01790 / 821078 AraportID:AT3G01790 Length:205 Species:Arabidopsis thaliana


Alignment Length:117 Identity:36/117 - (30%)
Similarity:53/117 - (45%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 WHIYDCTWQNPFESAKLVKTHLLGLQKPIYHPMNDCGDHVVLINTREIALPGDEWVKRVYFHHTG 81
            |.::|...|.....|..:.|.|....||.|.|..|.||..:::|.:||...|.:...:.|..|||
plant    32 WRVFDARGQVLGRLASQISTVLQAKDKPTYCPNRDDGDICIVLNAKEIGFTGRKLTDKFYRWHTG 96

  Fly    82 YPGGASWTLAWQLHEKDPTMVMKKAVYNSMRGNLQRRHTMQRLHLFADDQVP 133
            |.|............||||.|::|||:..:..|..|....::|.:|...:.|
plant    97 YIGHLKERSLKDQMAKDPTEVIRKAVWRMLPSNNLRDDRDRKLRIFEGGEHP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL13NP_523598.2 Ribosomal_L13 16..141 CDD:278969 36/117 (31%)
AT3G01790NP_186828.2 PLN00205 16..205 CDD:177795 36/117 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I3767
eggNOG 1 0.900 - - E1_COG0102
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2539
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1119705at2759
OrthoFinder 1 1.000 - - FOG0003171
OrthoInspector 1 1.000 - - otm3247
orthoMCL 1 0.900 - - OOG6_101118
Panther 1 1.100 - - O PTHR11545
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.