DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL13 and Mrpl13

DIOPT Version :9

Sequence 1:NP_523598.2 Gene:mRpL13 / 35145 FlyBaseID:FBgn0032720 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_081035.1 Gene:Mrpl13 / 68537 MGIID:2137218 Length:178 Species:Mus musculus


Alignment Length:174 Identity:84/174 - (48%)
Similarity:115/174 - (66%) Gaps:0/174 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SIAKRVQQWATFARTWHIYDCTWQNPFESAKLVKTHLLGLQKPIYHPMNDCGDHVVLINTREIAL 66
            |.::..||||||||.|::.|...|.|.:.|.:....|.||.||:||.::|||||||:||||.||.
Mouse     3 SFSRAPQQWATFARMWYLLDGKMQPPGKLAVIASNKLQGLNKPVYHQLSDCGDHVVIINTRHIAF 67

  Fly    67 PGDEWVKRVYFHHTGYPGGASWTLAWQLHEKDPTMVMKKAVYNSMRGNLQRRHTMQRLHLFADDQ 131
            .|::|.::||..|||||||.....|.|||.|||..::|.|:|..:..||.||..|||||||.|:.
Mouse    68 SGNKWEQKVYSSHTGYPGGFRQVTAAQLHRKDPVAIVKLAIYGMLPKNLHRRTMMQRLHLFPDED 132

  Fly   132 VPEEILQNVTNQIRTPRSIPQRLDHIDKETLENFPNIMDYPKDY 175
            :||:||:|:..::..||.:|:|||...:|.:|.||.:...|.|:
Mouse   133 IPEDILKNLVEELPQPRRVPKRLDEYTQEEIEAFPRVWTPPDDF 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL13NP_523598.2 Ribosomal_L13 16..141 CDD:278969 63/124 (51%)
Mrpl13NP_081035.1 Ribosomal_L13 17..140 CDD:278969 62/122 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837189
Domainoid 1 1.000 137 1.000 Domainoid score I4854
eggNOG 1 0.900 - - E1_COG0102
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90894
Inparanoid 1 1.050 186 1.000 Inparanoid score I3910
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62551
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003171
OrthoInspector 1 1.000 - - oto93315
orthoMCL 1 0.900 - - OOG6_101118
Panther 1 1.100 - - LDO PTHR11545
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4169
SonicParanoid 1 1.000 - - X3602
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.