DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL13 and mrpl13

DIOPT Version :9

Sequence 1:NP_523598.2 Gene:mRpL13 / 35145 FlyBaseID:FBgn0032720 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001016796.2 Gene:mrpl13 / 549550 XenbaseID:XB-GENE-1016174 Length:179 Species:Xenopus tropicalis


Alignment Length:177 Identity:84/177 - (47%)
Similarity:117/177 - (66%) Gaps:0/177 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SIAKRVQQWATFARTWHIYDCTWQNPFESAKLVKTHLLGLQKPIYHPMNDCGDHVVLINTREIAL 66
            |.::..||||||:|.|::.|...|.|.:.|.|...||.|..||:||.::|||||||::|||.||.
 Frog     3 SYSRSAQQWATFSRMWYLIDARMQPPGKVASLCAVHLKGKHKPMYHALSDCGDHVVVVNTRHIAF 67

  Fly    67 PGDEWVKRVYFHHTGYPGGASWTLAWQLHEKDPTMVMKKAVYNSMRGNLQRRHTMQRLHLFADDQ 131
            .|::|.::||..|:||.||.....|.|||::|||.:||.|||..:..||.||..|||||||.:|.
 Frog    68 SGNKWEQKVYSSHSGYAGGFQQVTAAQLHQRDPTAIMKLAVYGMLPKNLHRRTMMQRLHLFPEDD 132

  Fly   132 VPEEILQNVTNQIRTPRSIPQRLDHIDKETLENFPNIMDYPKDYILR 178
            :||||::|:..:|..||.:|:|||....|.:..||.:...|.|:|::
 Frog   133 IPEEIMKNLFAEIPQPRKVPRRLDEFSGEEINAFPKLWIPPPDFIMK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL13NP_523598.2 Ribosomal_L13 16..141 CDD:278969 63/124 (51%)
mrpl13NP_001016796.2 Ribosomal_L13 17..140 CDD:376351 62/122 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H90894
Inparanoid 1 1.050 181 1.000 Inparanoid score I3871
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1119705at2759
OrthoFinder 1 1.000 - - FOG0003171
OrthoInspector 1 1.000 - - oto103556
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3602
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.