powered by:
Protein Alignment mRpL13 and Rpl13a
DIOPT Version :9
Sequence 1: | NP_523598.2 |
Gene: | mRpL13 / 35145 |
FlyBaseID: | FBgn0032720 |
Length: | 178 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_775462.2 |
Gene: | Rpl13a / 317646 |
RGDID: | 628697 |
Length: | 203 |
Species: | Rattus norvegicus |
Alignment Length: | 33 |
Identity: | 10/33 - (30%) |
Similarity: | 14/33 - (42%) |
Gaps: | 0/33 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 HLLGLQKPIYHPMNDCGDHVVLINTREIALPGD 69
||||....|.......|..||::....|.:.|:
Rat 14 HLLGRLAAIVAKQVLLGRKVVVVRCEGINISGN 46
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0102 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.