DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL13 and mrpl23

DIOPT Version :9

Sequence 1:NP_523598.2 Gene:mRpL13 / 35145 FlyBaseID:FBgn0032720 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_596753.1 Gene:mrpl23 / 2540088 PomBaseID:SPBC16G5.04 Length:157 Species:Schizosaccharomyces pombe


Alignment Length:138 Identity:39/138 - (28%)
Similarity:64/138 - (46%) Gaps:3/138 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FARTWHIYDCTWQNPFESAKLVKTHLLGLQKPIYHPMNDCGDHVVLINTREIALPGDEWVKRVYF 77
            :|:.||............|..:.|.|:|..||||||..||||.||:.:..||.:.|.:.....|:
pombe    12 YAKVWHHVSAKNVPLGRLASQIATTLMGKHKPIYHPAADCGDVVVVTDCSEIGISGRKLENHKYY 76

  Fly    78 HHTGYPGG-ASWTLAWQLHEKDPTMVMKKAVYNSMRGNLQRRHTMQRLHLFADDQVPEEILQNVT 141
            .|:|.||. ..||:.....::....::::||...:..|......|:||:::...:.|.:  .|:.
pombe    77 SHSGQPGHLKEWTMEEMAAKRGHKDLLRRAVGGMLPRNKLWDRRMKRLYIYDGAEHPYK--ANIF 139

  Fly   142 NQIRTPRS 149
            .....|.|
pombe   140 RSYHNPVS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL13NP_523598.2 Ribosomal_L13 16..141 CDD:278969 36/125 (29%)
mrpl23NP_596753.1 Ribosomal_L13 16..137 CDD:278969 35/122 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I2979
eggNOG 1 0.900 - - E1_COG0102
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90894
Inparanoid 1 1.050 64 1.000 Inparanoid score I1982
OMA 1 1.010 - - QHG62551
OrthoFinder 1 1.000 - - FOG0003171
OrthoInspector 1 1.000 - - oto101143
orthoMCL 1 0.900 - - OOG6_101118
Panther 1 1.100 - - LDO PTHR11545
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4169
SonicParanoid 1 1.000 - - X3602
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.