DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL13 and Rpl13a

DIOPT Version :9

Sequence 1:NP_523598.2 Gene:mRpL13 / 35145 FlyBaseID:FBgn0032720 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_033464.2 Gene:Rpl13a / 22121 MGIID:1351455 Length:203 Species:Mus musculus


Alignment Length:65 Identity:13/65 - (20%)
Similarity:29/65 - (44%) Gaps:3/65 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 YPGGASWTLAWQLHEKDPTMVMKKAVYNSMRGNLQRRHTMQRLHLFADDQVPEEILQNVTNQIRT 146
            |.|..:..:.|:......|:..|:.....|  :.:::..:.||...|:..|.::|.: .|..::|
Mouse   137 YLGRLAHEVGWKYQAVTATLEEKRKEKAKM--HYRKKKQILRLRKQAEKNVEKKICK-FTEVLKT 198

  Fly   147  146
            Mouse   199  198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL13NP_523598.2 Ribosomal_L13 16..141 CDD:278969 11/58 (19%)
Rpl13aNP_033464.2 PTZ00068 6..191 CDD:240253 11/55 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0102
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.