DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL13 and rpl-13A

DIOPT Version :10

Sequence 1:NP_523598.2 Gene:mRpL13 / 35145 FlyBaseID:FBgn0032720 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001379064.1 Gene:rpl-13A / 175455 WormBaseID:WBGene00004428 Length:202 Species:Caenorhabditis elegans


Alignment Length:141 Identity:31/141 - (21%)
Similarity:43/141 - (30%) Gaps:40/141 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KTHLLGLQKPIYHPMNDCGDHVVLINTREIALPGDEWVKRVYFHHTGYPGGASWTLAWQLHEKDP 99
            |.||||....|.......||.||::...||.:.|:       ||.:..              |..
 Worm    13 KNHLLGRLASIVAKKLLQGDKVVVLRAEEIVISGN-------FHRSKL--------------KYM 56

  Fly   100 TMVMKKAVYNSMRGNLQRRHTMQRLHLFADDQVPEEILQNVTNQIRTPRSIPQRLDHIDKETLEN 164
            :.:.|:...|..||....|             .|.:|..      ||.|.:.....:...|.|:|
 Worm    57 SFLRKRCNINPARGAFHYR-------------APGKIFW------RTVRGMLPHKTNRGNEALKN 102

  Fly   165 FPNIMDYPKDY 175
            .......|..|
 Worm   103 LRAYEGVPAKY 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL13NP_523598.2 Ribosomal_L13 15..133 CDD:459856 21/97 (22%)
rpl-13ANP_001379064.1 Ribosomal_L13 5..202 CDD:469724 31/141 (22%)

Return to query results.
Submit another query.