DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17597 and NYC1

DIOPT Version :9

Sequence 1:NP_001286066.1 Gene:CG17597 / 35140 FlyBaseID:FBgn0032715 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_567400.1 Gene:NYC1 / 826942 AraportID:AT4G13250 Length:496 Species:Arabidopsis thaliana


Alignment Length:152 Identity:30/152 - (19%)
Similarity:56/152 - (36%) Gaps:54/152 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GRRADACYPDFAKEAITKALQDAG------------------IKF--EEVQQAVAGYVYGDSTC- 63
            |...|.|.|:..::....|:::.|                  ::|  |::.|.|:..:.|...| 
plant   231 GIACDVCKPEDVEKLSNFAVKELGSINIWINNAGTNKGFRPLLEFTEEDITQIVSTNLIGSILCT 295

  Fly    64 -GQRAIYEVGMTGIPVYNVNNNCSTGSS----ALYLAKQIVESGNSECVLALGFEKMERGSLSAK 123
             |...:.....:|..::|::...|.|||    |:|        |:::|.|     :...||    
plant   296 RGAMDVMSRQHSGGHIFNMDGAGSGGSSTPLTAVY--------GSTKCGL-----RQFHGS---- 343

  Fly   124 YFDRANPMERHITEMSELTEIG 145
                       |.:.|:.|.:|
plant   344 -----------IVKESQKTNVG 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17597NP_001286066.1 PRK08256 5..396 CDD:181327 30/152 (20%)
SCP-x_thiolase 9..395 CDD:238425 30/152 (20%)
NYC1NP_567400.1 SDR_c 164..395 CDD:212491 30/152 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24314
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.