DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17597 and yip2

DIOPT Version :9

Sequence 1:NP_001286066.1 Gene:CG17597 / 35140 FlyBaseID:FBgn0032715 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_523528.1 Gene:yip2 / 34313 FlyBaseID:FBgn0040064 Length:398 Species:Drosophila melanogaster


Alignment Length:445 Identity:96/445 - (21%)
Similarity:166/445 - (37%) Gaps:138/445 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GVGMTKFEKPGRRADACYPDFAKEAITKALQDAGIKFEEVQQAVAGYVYGDSTCGQRAIY---EV 71
            |:..|:.:....:|              ||..||:|.|:|...:.|.|...|:..  .||   .|
  Fly    27 GINQTQLQTTAAKA--------------ALDAAGLKGEQVDTVIVGNVIASSSTD--GIYVPRHV 75

  Fly    72 GMT-GIPV----YNVNNNCSTGSSALYLAKQIVESGNSECVLALGFEKMERGSLSAKYFDRANPM 131
            |:. |:|:    ..:|..|.:|..::....|.:..|.::..|..|.|.|.:....|:        
  Fly    76 GLNCGVPIEKPALGINRLCGSGFQSIVNGAQDILVGGAKIALTGGVENMSQSPFIAR-------- 132

  Fly   132 ERHITEMSELTEIGAG------------------PMAAQIFGNAGKEHMKKYGTKPEHFGKIAWK 178
                 .:...|.:||.                  |||......|.:..:.:  .:.:.|..::.|
  Fly   133 -----NVRFGTTLGASYNLEDALWAGLTDTYCKLPMALTAENLADQYKISR--ERVDEFSLLSQK 190

  Fly   179 NH----------------KHSVNNPYSQF------RDEYTLEQIMKSPQVVE--GVLTKLQCCPT 219
            |.                |..|......|      |.:.|:|.:.|.|.:.:  ||:|.......
  Fly   191 NWEKGQKEGAFNAEITPIKLKVKGKEVDFVVDEHPRPKTTIEGLNKLPSLFKKNGVVTAGTASGI 255

  Fly   220 SDGSGAAILASEAFVRRHGLEK----QAVEIVGME---MASDPASTFADKSLMKIAGTDMTRLAT 277
            .||:.|.|:|||..::.:.|:.    .|...||::   |...|..  |.::::|:          
  Fly   256 CDGASAVIVASEEALKEYNLKPLARLVAFSFVGVKPEIMGIGPVP--AIQNVLKV---------- 308

  Fly   278 ERLFAKSGYKPQDVQVVELHDCFSANELITYEALGLCGEGKAGEFIDAGDNTYGGKFVVNPSGGL 342
                  ||.|.:|:.::|:::.|:|..|...:||.|             |.:     .:|.:||.
  Fly   309 ------SGKKLEDIDLIEINEAFAAQTLACADALKL-------------DTS-----KLNVNGGA 349

  Fly   343 ISKGHPLGATGLAQCAELCWQLRGLAEKRQVPNAQLALQHNLG---LGGAVVVAL 394
            |:.||||||:|......|..:|:           :..|::.:|   :||...:||
  Fly   350 IALGHPLGASGSRITGHLVHELQ-----------RKKLKYGIGSACIGGGQGIAL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17597NP_001286066.1 PRK08256 5..396 CDD:181327 96/445 (22%)
SCP-x_thiolase 9..395 CDD:238425 96/445 (22%)
yip2NP_523528.1 PRK05790 6..398 CDD:180261 96/445 (22%)
thiolase 9..397 CDD:238383 96/445 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448490
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.