DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17597 and CG10932

DIOPT Version :9

Sequence 1:NP_001286066.1 Gene:CG17597 / 35140 FlyBaseID:FBgn0032715 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001284987.1 Gene:CG10932 / 31695 FlyBaseID:FBgn0029969 Length:410 Species:Drosophila melanogaster


Alignment Length:408 Identity:92/408 - (22%)
Similarity:154/408 - (37%) Gaps:95/408 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AITKALQDAGIKFEEVQQAVAGYV----YGDSTCGQRAIYEVGMTGIPVYNVNNNCSTGSSALYL 94
            ||..|::.|||...:||:.:.|.|    .|.:...|.||:....|.:....||..||:|..|:.|
  Fly    54 AIEAAIEKAGIAKTDVQEVIMGNVVSAGLGQAPARQAAIFAGLPTNVCCTTVNKVCSSGMKAVML 118

  Fly    95 AKQIVESGNSECVLALGFEKMERGSLSAKYFDRANPMERHITEMSELTEIGAGPMAAQIF----- 154
            ..|.:..|.::.|:|.|.|.|.    :..|:     ::|..|...     |.......:|     
  Fly   119 GAQSLMLGYADVVVAGGMESMS----NVPYY-----LKRGATPYG-----GVNLTDGIVFDGLWD 169

  Fly   155 -------GNAGKEHMKKYGTKPEHFGKIAWKNHKHSVNNPYSQ-FRDEYTLEQIM--KSPQVV-- 207
                   ||..:...||.....:.....|.:::|.|.....:: |:||....:|.  :.|::|  
  Fly   170 VYNKFHMGNCAENTAKKLEITRQQQDDFAIESYKRSAAAWANKVFQDEIAPVKIQQKRKPEIVIS 234

  Fly   208 -----------------------EGVLTKLQCCPTSDGSGAAILASEAFVRRHGLEKQAVEIVGM 249
                                   .|.:|.......:||..|.:|.|....::.|::..|..:...
  Fly   235 EDEEYKRVNFDKFGQLATVFQRENGTVTAGNASTLNDGGAAVVLMSAEAAQKAGIKPLARIVAFQ 299

  Fly   250 EMASDPASTFADKSLMKIAGTDMTRLATERLFAKSGYKPQDVQVVELHDCFSANELITYEALGLC 314
            :..:||..       ..||    ..||..:|..::|.:.:||.:.|:::.||...|...:.|.  
  Fly   300 DAETDPID-------FPIA----PALAIPKLLKRAGVRKEDVAMWEVNEAFSLVVLANIKKLD-- 351

  Fly   315 GEGKAGEFIDAGDNTYGGKFVVNPSGGLISKGHPLGATGLAQCAELCWQLRGLAEKRQVPNAQLA 379
                    :|...        ||..||.:|.|||:|.:|....|.|...|:    |.::..|.:.
  Fly   352 --------VDPAK--------VNVHGGAVSIGHPIGMSGARLVAHLSHSLK----KGELGCASIC 396

  Fly   380 LQHNLGLGGAVVVALYRL 397
                .|.|||..:.:.:|
  Fly   397 ----NGGGGASSILIEKL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17597NP_001286066.1 PRK08256 5..396 CDD:181327 91/405 (22%)
SCP-x_thiolase 9..395 CDD:238425 91/404 (23%)
CG10932NP_001284987.1 PLN02644 24..410 CDD:215347 91/406 (22%)
thiolase 26..409 CDD:238383 91/405 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448486
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.