DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT85A4

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_177950.1 Gene:UGT85A4 / 844162 AraportID:AT1G78270 Length:489 Species:Arabidopsis thaliana


Alignment Length:288 Identity:63/288 - (21%)
Similarity:114/288 - (39%) Gaps:65/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 VRNTSLMLVN-----QHFSLSGPKPLPPNVIEVGGVHISPPKPLP--SDLQKI------------ 283
            ::..|.:.:|     :|..|...:.|.|.:..||...|...:.:.  |:::|:            
plant   223 IKRASAIFINTFEKLEHNVLLSLRSLLPQIYSVGPFQILENREIDKNSEIRKLGLNLWEEETESL 287

  Fly   284 --LD-NAPKGVILISWGSQLKACSLSAARRDGIVK---AIGRLEQEVIWKY-------ENDTLP- 334
              || .|.|.||.:::|      ||:....:.|::   .:.|..:|.:|..       ::..|| 
plant   288 DWLDTKAEKAVIYVNFG------SLTVLTSEQILEFAWGLARSGKEFLWVVRSGMVDGDDSILPA 346

  Fly   335 -----NKPPNLHIRKWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLNIAA 394
                 .|...:.|:.|..|..:|:||.:..|::|.|...|.|::.:.||::..|.:.||..|...
plant   347 EFLSETKNRGMLIKGWCSQEKVLSHPAIGGFLTHCGWNSTLESLYAGVPMICWPFFADQLTNRKF 411

  Fly   395 LVQR---GMALQLELKKLDENTVYEALTKALDPSFKARAKEVASSYNNRIQGPLETAIWWVEHVA 456
            ..:.   ||.:..|:|:....||.:.|   :|.....|.:              |..:.| ..:|
plant   412 CCEDWGIGMEIGEEVKRERVETVVKEL---MDGEKGKRLR--------------EKVVEW-RRLA 458

  Fly   457 ETKGAPLTQPSAVHLSRFVYYSLDVYSV 484
            |...||....|.|:....|...|..:::
plant   459 EEASAPPLGSSYVNFETVVNKVLTCHTI 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 57/262 (22%)
UGT85A4NP_177950.1 Glycosyltransferase_GTB-type 5..480 CDD:415824 62/280 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.