DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and AT1G50580

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_175473.1 Gene:AT1G50580 / 841480 AraportID:AT1G50580 Length:448 Species:Arabidopsis thaliana


Alignment Length:143 Identity:34/143 - (23%)
Similarity:59/143 - (41%) Gaps:45/143 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 VHISPPKPLPSDLQKILDNAPKGVILISWGSQLKACSLSAARRDGIVKAIGRLEQEVIWKYENDT 332
            :.:.|||..|: :|:.|   |||.                   :..||..|     ::|:     
plant   286 ISVMPPKGSPT-VQEAL---PKGF-------------------EERVKKHG-----IVWE----- 317

  Fly   333 LPNKPPNLHIRKWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLNIAALVQ 397
                       .||.|..||:||::..|::|.|.....|::.|...||.:|...||.| |..|:.
plant   318 -----------GWLEQPLILSHPSVGCFVNHCGFGSMWESLVSDCQIVFIPQLADQVL-ITRLLT 370

  Fly   398 RGMALQLELKKLD 410
            ..:.:.:::::.|
plant   371 EELEVSVKVQRED 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 34/143 (24%)
AT1G50580NP_175473.1 PLN00414 1..446 CDD:177807 34/143 (24%)
MGT 14..419 CDD:273616 34/143 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.