DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT74B1

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_173820.1 Gene:UGT74B1 / 839022 AraportID:AT1G24100 Length:460 Species:Arabidopsis thaliana


Alignment Length:394 Identity:83/394 - (21%)
Similarity:143/394 - (36%) Gaps:130/394 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 STLTDTISLEDFERPYSFL------FH---YVEFFILHKMGREDCNTTLHSRALTEILKNPPGYY 132
            |..|.::|:|.....:.|:      |.   |.|.|.|:           .|..||          
plant    51 SITTPSLSVEPISDGFDFIPIGIPGFSVDTYSESFKLN-----------GSETLT---------- 94

  Fly   133 DVILLEQF-NTDCAMSVAHVFQAPVIGMSSCALMPWHYERFGAPLIPSYISALFQGQSQEMSFAG 196
              :|:|:| :||          :|:..:...:.:||..|               ..:|.|:|.|.
plant    95 --LLIEKFKSTD----------SPIDCLIYDSFLPWGLE---------------VARSMELSAAS 132

  Fly   197 RLGNWITVHSLNLLYKM----FTVPA--GNALIRQRFGPGLPST--EDLV--------------- 238
            ...|.:||.|  :|.|.    |.:||  .:|..|.|   ||||.  ::|.               
plant   133 FFTNNLTVCS--VLRKFSNGDFPLPADPNSAPFRIR---GLPSLSYDELPSFVGRHWLTHPEHGR 192

  Fly   239 ---------RNTSLMLVNQHFSLSGPK----------------PLPPNVI---------EVGGVH 269
                     .|...:.||....|...:                |:.|:..         :.|.  
plant   193 VLLNQFPNHENADWLFVNGFEGLEETQDCENGESDAMKATLIGPMIPSAYLDDRMEDDKDYGA-- 255

  Fly   270 ISPPKPLPSDLQKILD-NAPKGVILISWGS-----QLKACSLSAARRDGIVKAIGRLEQEVIWKY 328
             |..||:..:..:.|: ...:.|..:|:||     :.:...::.|.::..:..:..:::..|.|.
plant   256 -SLLKPISKECMEWLETKQAQSVAFVSFGSFGILFEKQLAEVAIALQESDLNFLWVIKEAHIAKL 319

  Fly   329 ENDTLPNKPPNLHIRKWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLNIA 393
            ....:.:......:..|..|.::|||.::..|::|.|...|.|.:|..||:||||.:.|| :|.|
plant   320 PEGFVESTKDRALLVSWCNQLEVLAHESIGCFLTHCGWNSTLEGLSLGVPMVGVPQWSDQ-MNDA 383

  Fly   394 ALVQ 397
            ..|:
plant   384 KFVE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 83/394 (21%)
UGT74B1NP_173820.1 Glycosyltransferase_GTB-type 7..455 CDD:415824 83/394 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.