DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT85A1

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_173656.1 Gene:UGT85A1 / 838846 AraportID:AT1G22400 Length:489 Species:Arabidopsis thaliana


Alignment Length:274 Identity:65/274 - (23%)
Similarity:106/274 - (38%) Gaps:69/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 LPSTEDLVRNTSLMLVN----QHFSLSGPKPLPPNVIEVGGVHI---------SPPKPLPSDLQK 282
            |..||...|.::::|..    :|..:...:.:.|.|..||.:|:         |....:.|:|.|
plant   219 LRETERAKRASAIILNTFDDLEHDVVHAMQSILPPVYSVGPLHLLANREIEEGSEIGMMSSNLWK 283

  Fly   283 ----ILD----NAPKGVILISWGSQLKACSLSAARRDGIVKAIGRLEQEVIWKYENDTLPNK--- 336
                .||    .....||.|::||   ...||..:.......:....:|.:|....|.:..:   
plant   284 EEMECLDWLDTKTQNSVIYINFGS---ITVLSVKQLVEFAWGLAGSGKEFLWVIRPDLVAGEEAM 345

  Fly   337 -PPNL--------HIRKWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLN- 391
             ||:.        .:..|.||..:|:||.:..|::|.|.....|::|..||:|..|.:.||.:| 
plant   346 VPPDFLMETKDRSMLASWCPQEKVLSHPAIGGFLTHCGWNSILESLSCGVPMVCWPFFADQQMNC 410

  Fly   392 ------------IAALVQRG--MALQLEL------KKLDENTV-YEALTKALDPSFKARAKEVAS 435
                        |...|:|.  .|:..||      ||:.|..| ::.|.:      ||...::.|
plant   411 KFCCDEWDVGIEIGGDVKREEVEAVVRELMDGEKGKKMREKAVEWQRLAE------KATEHKLGS 469

  Fly   436 SYNNRIQGPLETAI 449
            |..|     .||.:
plant   470 SVMN-----FETVV 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 65/274 (24%)
UGT85A1NP_173656.1 Glycosyltransferase_GTB_type 14..453 CDD:299143 56/236 (24%)
MGT 20..454 CDD:273616 56/237 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.