DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT75B2

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_172044.1 Gene:UGT75B2 / 837055 AraportID:AT1G05530 Length:455 Species:Arabidopsis thaliana


Alignment Length:352 Identity:76/352 - (21%)
Similarity:128/352 - (36%) Gaps:99/352 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 HYERFGAPLIPSYISALFQGQSQEMSFAGR-LGNWITVHSLNLLYKMFTVPAGNALIRQRFG--- 228
            |:||.|...:..:|.|...|.|........ |.||:.     .:.:.|.:|:.:..|:..|.   
plant    84 HFERNGDKALSDFIEANQNGDSPVSCLIYTILPNWVP-----KVARRFHLPSVHLWIQPAFAFDI 143

  Fly   229 --------------PGLPSTE-------------------------DLVRNTS--LMLVNQHFSL 252
                          |.|||.|                         |.::..|  .:|||...||
plant   144 YYNYSTGNNSVFEFPNLPSLEIRDLPSFLSPSNTNKAAQAVYQELMDFLKEESNPKILVNTFDSL 208

  Fly   253 SGPK--------------PLPPNVIEVGGVHISPPKPLPSDLQKI-----LDN-APKGVILISWG 297
            . |:              ||.|..|..|.   ...|.|..|.|..     ||: ....||.:|:|
plant   209 E-PEFLTAIPNIEMVAVGPLLPAEIFTGS---ESGKDLSRDHQSSSYTLWLDSKTESSVIYVSFG 269

  Fly   298 SQLKACSLSAARRDGIVKAI---GR---------LEQEVIWKYENDTLPNKPPNLH--------I 342
            :.::   ||..:.:.:.:|:   ||         |.:|...:.|.:|...|.....        |
plant   270 TMVE---LSKKQIEELARALIEGGRPFLWVITDKLNREAKIEGEEETEIEKIAGFRHELEEVGMI 331

  Fly   343 RKWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLNIAALVQRGMALQLELK 407
            ..|..|.::|.|..:..|::|.|...:.|::...||:|..|::.||..| |.|::......:.::
plant   332 VSWCSQIEVLRHRAIGCFLTHCGWSSSLESLVLGVPVVAFPMWSDQPAN-AKLLEEIWKTGVRVR 395

  Fly   408 KLDENTVYEA-LTKALDPSFKARAKEV 433
            :..|..|... :.:.|:...:|::.|:
plant   396 ENSEGLVERGEIMRCLEAVMEAKSVEL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 76/352 (22%)
UGT75B2NP_172044.1 PLN02152 1..455 CDD:177813 76/352 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.