DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT76E2

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_200767.1 Gene:UGT76E2 / 836078 AraportID:AT5G59590 Length:449 Species:Arabidopsis thaliana


Alignment Length:482 Identity:112/482 - (23%)
Similarity:180/482 - (37%) Gaps:122/482 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LFPHPAISHFKFFHPIMRGLAEAGHSVDVISPFEDKDPPNGYKD----HLLP-PSTLTDTISLED 87
            |.|.||..|......:.:.|...|.|:.|:  ....:..:..||    |.|. |.:||::    |
plant    13 LVPVPAQGHVTPMMQLGKALHSKGFSITVV--LTQSNRVSSSKDFSDFHFLTIPGSLTES----D 71

  Fly    88 FER--PYSFLFHYVEFFILHKMGREDCNTTLHSRALTEILKNPPGYYDVILLEQFNTDCA----- 145
            .:.  |..|:...          .:.|..:. .:.:.::|.           ||.|.|.|     
plant    72 LQNLGPQKFVLKL----------NQICEASF-KQCIGQLLH-----------EQCNNDIACVVYD 114

  Fly   146 --MSVAHV----FQAPVIGMSSCALMPW----HYERFGAPLIPSYISALFQGQSQEMSFAGRLGN 200
              |..:|.    ||.|.:..|:.:...:    ...|..|   .|::..:...::|:..|.|    
plant   115 EYMYFSHAAVKEFQLPSVVFSTTSATAFVCRSVLSRVNA---ESFLIDMKDPETQDKVFPG---- 172

  Fly   201 WITVHSLNLLYKMFTVPAGNALIRQRFGPGLPSTEDL------VRNTSLMLVNQHFSLSG----- 254
               :|.|.  ||        .|....||| :.||..:      .|..|.:::|....|..     
plant   173 ---LHPLR--YK--------DLPTSVFGP-IESTLKVYSETVNTRTASAVIINSASCLESSSLAR 223

  Fly   255 -PKPLPPNVIEVGGVHISPPKP---LPSD------LQKILDNAPKGVILISWGSQLKACSLSAAR 309
             .:.|...|..:|.:||:...|   |..|      |.|...|:   ||.||.||.....:     
plant   224 LQQQLQVPVYPIGPLHITASAPSSLLEEDRSCVEWLNKQKSNS---VIYISLGSLALMDT----- 280

  Fly   310 RDGIVKAIG--RLEQEVIWKYE---------NDTLPNKPPNL-----HIRKWLPQRDILAHPNLK 358
            :|.:..|.|  ...|..:|...         .::||.:...|     :|.||.||.::|.||.:.
plant   281 KDMLEMAWGLSNSNQPFLWVVRPGSIPGSEWTESLPEEFNRLVSERGYIVKWAPQMEVLRHPAVG 345

  Fly   359 VFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLNIAALVQRGMALQLELK-KLDENTVYEALTKAL 422
            .|.||.|...|.|::...||::..|..|||.:| |..::|...:.::|: .||:.||..|:...|
plant   346 GFWSHCGWNSTVESIGEGVPMICRPFTGDQKVN-ARYLERVWRIGVQLEGDLDKETVERAVEWLL 409

  Fly   423 DPSFKARAKEVASSYNNRIQGPLETAI 449
            .....|..::.|.....:|    ||::
plant   410 VDEEGAEMRKRAIDLKEKI----ETSV 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 112/482 (23%)
UGT76E2NP_200767.1 Glycosyltransferase_GTB-type 1..449 CDD:415824 112/482 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.