DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and AT5G38010

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_198617.1 Gene:AT5G38010 / 833780 AraportID:AT5G38010 Length:453 Species:Arabidopsis thaliana


Alignment Length:477 Identity:110/477 - (23%)
Similarity:172/477 - (36%) Gaps:130/477 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RILGLFPHPAISHFKFFHPIMRGLAEAGHSVDVISPFEDKDPPNGYKDHLLPPSTLTDTISLEDF 88
            |.:.|.|.||..|......:.|.|...|.|:.|...          |.:.|.||.     .|.||
plant     9 RRIVLIPAPAQGHISPMMQLARALHLKGFSITVAQT----------KFNYLKPSK-----DLADF 58

  Fly    89 E-------RPYSFLFHYVEFFILHKMGREDCNTTLHSRALTEILKN----PPGYYDVILLEQFNT 142
            :       .|.|.|.:....:.|.|:.:| |..:. ...|.::|..    |......::.::| .
plant    59 QFITIPESLPASDLKNLGPVWFLLKLNKE-CEFSF-KECLGQLLLQKQLIPEEEIACVIYDEF-M 120

  Fly   143 DCAMSVAHVFQAPVIGMSS------------CALMPWHYERFGAPLIPSYISALFQGQSQEMSFA 195
            ..|.:.|..|..|.:..|:            |.|    |.:.|       ::.|.:|..:|....
plant   121 YFAEAAAKEFNLPKVIFSTENATAFACRSAMCKL----YAKDG-------LAPLKEGCGREEELV 174

  Fly   196 GRLGNWITVHSLNLLYKMFTVPAGNALIRQRFGPGLPSTE------------DLVRNT------- 241
            .:|      |.|.  ||.....|        |.|...|.|            .::.||       
plant   175 PKL------HPLR--YKDLPTSA--------FAPVEASVEVFKSSCDKGTASAMIINTVRCLEIS 223

  Fly   242 SLMLVNQHFSLSGPKPLPPNVIEVGGVHI---SPPKPLPSDLQKILD----NAPKGVILISWGS- 298
            ||..:.|...:    |:.|    :|.:|:   :||..|..:.:..:|    ..|..||.||.|| 
plant   224 SLEWLQQELKI----PIYP----IGPLHMVSSAPPTSLLDENESCIDWLNKQKPSSVIYISLGSF 280

  Fly   299 ---QLKACSLSAARRDGIVKAIGRLEQEVIW----------KYENDTLPNK---PPNLHIRKWLP 347
               :.|.....|:   |:|.:    .|..:|          :..|:.|.:.   |...:|.||.|
plant   281 TLLETKEVLEMAS---GLVSS----NQHFLWVIRPGSILGSELTNEELLSMMEIPDRGYIVKWAP 338

  Fly   348 QRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLN---IAALVQRGMALQLELKK- 408
            |:.:|||..:..|.||.|...|.|::...||::..|...||.:|   :..:.:.|:.::.|||: 
plant   339 QKQVLAHSAVGAFWSHCGWNSTLESMGEGVPMICRPFTTDQKVNARYVECVWRVGVQVEGELKRG 403

  Fly   409 LDENTVYEALTKALDPSFKARA 430
            :.|..|...|........|.||
plant   404 VVERAVKRLLVDEEGEEMKLRA 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 110/477 (23%)
AT5G38010NP_198617.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 110/477 (23%)
YjiC 8..433 CDD:224732 110/477 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.