DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and AT5G37950

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:375 Identity:84/375 - (22%)
Similarity:133/375 - (35%) Gaps:112/375 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KDHLLPPSTLTDTISLEDFE-------RPYSFLFHYVEFFILHKMGREDCNTTLHSRALTEILKN 127
            |.:.|.||.     .|.||:       .|.|.|......:.:.|:.:| |..:. .:.|.:.|..
plant    21 KFNYLNPSK-----DLADFQFITIPESLPASDLKTLGPIWFIIKLNKE-CEISF-KKCLGQFLLQ 78

  Fly   128 PPGYYDVILLEQFNTDCAMSVAHVFQAPVIGMSS------------CALMPWHYERFGAPLIPSY 180
            .......::.::| ...|.:.|..|..|.:..|:            |.|    |.:.|       
plant    79 QQEEIACVIYDEF-MYFAEAAAKEFNLPKVIFSTENATAFACRSAMCKL----YAKDG------- 131

  Fly   181 ISALFQGQSQEMSFAGRLGNWITVHSLNLLYKMFTVPAGNALIRQRFGPGLPSTE---------- 235
            |:.|.:|..:|......|      |.|.  ||.....|        |.|...|.|          
plant   132 IAPLTEGCGREEELVPEL------HPLR--YKDLPTSA--------FAPVEASVEVFKSSCEKGT 180

  Fly   236 --DLVRNT-------SLMLVNQHFSLSGPKPLPPNVIEVGGVHI---SPPKPLPSDLQKILD--- 285
              .::.||       ||..:.|...:    |:.|    :|.:::   :||..|..:.:..:|   
plant   181 ASSMIINTVSCLEISSLEWLQQELKI----PIYP----IGPLYMVSSAPPTSLLDENESCIDWLN 237

  Fly   286 -NAPKGVILISWGS----QLKACSLSAARRDGIVKAIGRLEQEVIW----------KYENDTLPN 335
             ..|..||.||.||    :.|.....|:   |:|.:    .|..:|          :..|:.|.:
plant   238 KQKPSSVIYISLGSFTLLETKEVLEMAS---GLVSS----NQYFLWAIRPGSILGSELSNEELFS 295

  Fly   336 K---PPNLHIRKWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGV 382
            .   |...:|.||..|:.:|||..:..|.||.|...|.|::...:||||:
plant   296 MMEIPDRGYIVKWATQKQVLAHAAVGAFWSHCGWNSTLESIGEGIPIVGL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 84/375 (22%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 81/371 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.