DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and AT5G03490

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_195969.1 Gene:AT5G03490 / 831823 AraportID:AT5G03490 Length:465 Species:Arabidopsis thaliana


Alignment Length:443 Identity:91/443 - (20%)
Similarity:169/443 - (38%) Gaps:125/443 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PHPAISHFKFFHPIMRGLAEAGHS--VDVISPFEDKDPP--NGYKDHLLPPSTLTDTISLEDFER 90
            |||::|      |.:..:.:.|:|  :.:::.......|  |.::.|..||..|     :.||..
plant    80 PHPSLS------PGVENVKDVGNSGNLPIMASLRQLREPIINWFQSHPNPPIAL-----ISDFFL 133

  Fly    91 PYS-----------FLFHYVEFFILHKMGREDCNTTLHSRALTEILKNPPGYYDVILLEQFNTDC 144
            .::           |.|..:.||::..:  :.|                  :.::.|::  :|| 
plant   134 GWTHDLCNQIGIPRFAFFSISFFLVSVL--QFC------------------FENIDLIK--STD- 175

  Fly   145 AMSVAHVFQAPVIGMSSCALMPWHYERFGAPLIPSYISALFQGQSQEMSFAGRLGNWITVHSLNL 209
            .:.:..:.:||:               |....:||.:....|..|.::..       |...|:||
plant   176 PIHLLDLPRAPI---------------FKEEHLPSIVRRSLQTPSPDLES-------IKDFSMNL 218

  Fly   210 LYKMFTVPAGNALIRQRFGPGLPSTEDLVRNTSLMLVNQHFS-----LSGPKPLPPNVIEVGGVH 269
            |               .:|....|:| ::.:..|..|.|...     :.||      :..:|...
plant   219 L---------------SYGSVFNSSE-ILEDDYLQYVKQRMGHDRVYVIGP------LCSIGSGL 261

  Fly   270 ISPPKPLPSDLQKILDNAPKG-VILISWGSQLKACSLSAARRDGIVKAIGRLEQEVIWKYENDTL 333
            .|....:...|...||.:|.| |:.:.:||| ||  |:..:.|.:...:.:.....:|..:.|.:
plant   262 KSNSGSVDPSLLSWLDGSPNGSVLYVCFGSQ-KA--LTKDQCDALALGLEKSMTRFVWVVKKDPI 323

  Fly   334 PN------KPPNLHIRKWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLNI 392
            |:      ....|.:|.|:.|..:|.|..:..|:||.|.....|.::|...|:|.|:..||.:|.
plant   324 PDGFEDRVSGRGLVVRGWVSQLAVLRHVAVGGFLSHCGWNSVLEGITSGAVILGWPMEADQFVNA 388

  Fly   393 AALVQR-GMALQL-----------ELKKLDENTVYEALTKALDPSFKARAKEV 433
            ..||:. |:|:::           ||.::...|:.|.     .....|||:|:
plant   389 RLLVEHLGVAVRVCEGGETVPDSDELGRVIAETMGEG-----GREVAARAEEI 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 91/443 (21%)
AT5G03490NP_195969.1 Glycosyltransferase_GTB_type 19..460 CDD:299143 91/443 (21%)
YjiC 19..447 CDD:224732 91/443 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.