DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT78D2

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_197207.1 Gene:UGT78D2 / 831568 AraportID:AT5G17050 Length:460 Species:Arabidopsis thaliana


Alignment Length:295 Identity:73/295 - (24%)
Similarity:104/295 - (35%) Gaps:106/295 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 GNWITVHSLNLLYKM-FTVPAGNAL---------------IRQRF------GP-GLPST--EDLV 238
            ||..:|.| .:|::| ..:|...|:               :|.||      || ||.|:  :.||
plant   198 GNLDSVFS-KMLHQMGLALPRATAVFINSFEDLDPTLTNNLRSRFKRYLNIGPLGLLSSTLQQLV 261

  Fly   239 RNTSLMLVNQHFSLSGPKPLPPNVIEVG-GVHISPPKPLPSDLQKILDNAPKGVILISWG----- 297
            ::....|.......||      :|..:. |..::||   |.:|..|.:......:...|.     
plant   262 QDPHGCLAWMEKRSSG------SVAYISFGTVMTPP---PGELAAIAEGLESSKVPFVWSLKEKS 317

  Fly   298 -SQLKACSLSAARRDGIVKAIGRLEQEVIWKYENDTLPNKPPNLHIRKWLPQRDILAHPNLKVFM 361
             .||....|...|..|||                  :|          |.||.::|.|....||:
plant   318 LVQLPKGFLDRTREQGIV------------------VP----------WAPQVELLKHEATGVFV 354

  Fly   362 SHGGLMGTTEAVSSAVPIVGVPIYGDQSLNIAA----------------------------LVQ- 397
            :|.|.....|:||..||::..|.:|||.||..|                            ||| 
plant   355 THCGWNSVLESVSGGVPMICRPFFGDQRLNGRAVEVVWEIGMTIINGVFTKDGFEKCLDKVLVQD 419

  Fly   398 RGMALQLELKKLDENTVYEALTKALDPSFKARAKE 432
            .|..::...|||.| ..|||:      |.|.|:.|
plant   420 DGKKMKCNAKKLKE-LAYEAV------SSKGRSSE 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 73/295 (25%)
UGT78D2NP_197207.1 GT1_Gtf-like 12..438 CDD:340817 67/278 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.