DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT78D3

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:287 Identity:62/287 - (21%)
Similarity:106/287 - (36%) Gaps:64/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 ISALFQGQSQEMSFAGRLGNWITVHSLNLLYKMFTVPAGNALIRQ-RFGP----GLPSTEDLVRN 240
            :.::|.....:|..|......:.::|...|...||....:...|. ..||    ..||      .
plant   197 LDSVFSKTLHQMGLALPRATAVFINSFEELDPTFTNDFRSEFKRYLNIGPLALLSSPS------Q 255

  Fly   241 TSLMLVNQHFSLSG-PKPLPPNVIEVGGVHISPPKPLPSDLQKILDNAPKGVILISWGSQ----- 299
            ||.::.:.|..|:. .|....:|..:....::.|.|:  :|..|........:...|..|     
plant   256 TSTLVHDPHGCLAWIEKRSTASVAYIAFGRVATPPPV--ELVAIAQGLESSKVPFVWSLQEMKMT 318

  Fly   300 -LKACSLSAARRDGIVKAIGRLEQEVIWKYENDTLPNKPPNLHIRKWLPQRDILAHPNLKVFMSH 363
             |....|...|..|:|                  :|          |.||.::|.|..:.||:||
plant   319 HLPEGFLDRTREQGMV------------------VP----------WAPQVELLNHEAMGVFVSH 355

  Fly   364 GGLMGTTEAVSSAVPIVGVPIYGDQSLN---IAALVQRGMALQLELKKLD--ENTVYEALTKALD 423
            ||.....|:||:.||::..||:||.::|   :.|:.:.|:.:...:...|  |.::...|.:...
plant   356 GGWNSVLESVSAGVPMICRPIFGDHAINARSVEAVWEIGVTISSGVFTKDGFEESLDRVLVQDDG 420

  Fly   424 PSFKARAKEV-----------ASSYNN 439
            ...|..||::           .||:.|
plant   421 KKMKVNAKKLEELAQEAVSTKGSSFEN 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 62/287 (22%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 62/287 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.