DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and AT5G05880

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_196207.1 Gene:AT5G05880 / 830473 AraportID:AT5G05880 Length:451 Species:Arabidopsis thaliana


Alignment Length:515 Identity:100/515 - (19%)
Similarity:156/515 - (30%) Gaps:222/515 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SDSLRILGLFP-------HPAISHFKFFHPIMRGLAEAGHSVDVI-----SPFEDKDPPNGYKDH 72
            |:.||:: |||       :|.|...|..|       ..|.|:.||     :|.....|       
plant     4 SNGLRVI-LFPLPLQGCINPMIQLAKILH-------SRGFSITVIHTCFNAPKASSHP------- 53

  Fly    73 LLPPSTLTDTISLEDFERPYSFLFHYVEFFILHKMGREDCNTTLHSRALTEILKNPPGYYDV-IL 136
                                  ||.:::.    :.|..:..|...               || :|
plant    54 ----------------------LFTFIQI----QDGLSETETRTR---------------DVKLL 77

  Fly   137 LEQFNTDCAMSVAHVFQAPVIGMSSCALMPWHYERFGAPLIPSYISALFQGQSQEMSFAGRLGN- 200
            :...|.:|        ::||   ..|                  :..|.|...:|......|.| 
plant    78 ITLLNQNC--------ESPV---REC------------------LRKLLQSAKEEKQRISCLIND 113

  Fly   201 --WI-TVH---SLNLL------YKM------FTVPAGNALIRQRFGPGLPSTED-------LVRN 240
              || |.|   ||||:      ||:      |.:|   .|.|:.|.|...|.:|       .:|.
plant   114 SGWIFTQHLAKSLNLMRLAFNTYKISFFRSHFVLP---QLRREMFLPLQDSEQDDPVEKFPPLRK 175

  Fly   241 TSLMLVNQHFSLSGPKPLPPNVIEVGGVHISPPKPLPSDLQKILDNAPKGVILISWGSQLKACSL 305
            ..|:.:.:..|:.|..                    .||:......|..|:|.:|. .:|...||
plant   176 KDLLRILEADSVQGDS--------------------YSDMILEKTKASSGLIFMSC-EELDQDSL 219

  Fly   306 SAARRD----------------------------------------------GIVKAIGRLE-QE 323
            |.:|.|                                              |.:..|...| .|
plant   220 SQSREDFKVPIFAIGPSHSHFPASSSSLFTPDETCIPWLDRQEDKSVIYVSIGSLVTINETELME 284

  Fly   324 VIWKYENDTLP----------------NKPPNLHIR---------KWLPQRDILAHPNLKVFMSH 363
            :.|...|...|                ...|...|:         ||.||:::|.|..:..|::|
plant   285 IAWGLSNSDQPFLWVVRVGSVNGTEWIEAIPEYFIKRLNEKGKIVKWAPQQEVLKHRAIGGFLTH 349

  Fly   364 GGLMGTTEAVSSAVPIVGVPIYGDQSLNIAALVQRGMALQLELK-KLDENTVYEALTKAL 422
            .|...|.|:|...||::.:|...||.|| |..|.....:.:.|: :::.:.:..|:.:.|
plant   350 NGWNSTVESVCEGVPMICLPFRWDQLLN-ARFVSDVWMVGIHLEGRIERDEIERAIRRLL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 100/515 (19%)
AT5G05880NP_196207.1 Glycosyltransferase_GTB-type 2..451 CDD:385653 100/515 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.