DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT71B5

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001328018.1 Gene:UGT71B5 / 827194 AraportID:AT4G15280 Length:510 Species:Arabidopsis thaliana


Alignment Length:399 Identity:86/399 - (21%)
Similarity:149/399 - (37%) Gaps:94/399 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LHSRALTEILKNPP-----GYYDVILLEQFNTDCAMSVAHVFQAP-------VIGMSSCALMPWH 168
            ||..::: :.|.||     .....:.:|:..|....:||.....|       |:.| .|:.|...
plant    97 LHYESIS-VAKQPPTSDPDPVPAQVYIEKQKTKVRDAVAARIVDPTRKLAGFVVDM-FCSSMIDV 159

  Fly   169 YERFGAPLIPSYIS-ALFQG--------QSQEMSFAGRLGNWIT---VHSLNLLYKMFTVPAGNA 221
            ...||.|....|.| |.|.|        ..|:......|.|.:|   ..||...|.:..:|  :.
plant   160 ANEFGVPCYMVYTSNATFLGTMLHVQQMYDQKKYDVSELENSVTELEFPSLTRPYPVKCLP--HI 222

  Fly   222 LIRQRFGPGLPSTEDLVRNTSLMLVN----------QHFSLSGPKPLPPNVIEVGGV-HI---SP 272
            |..:.:.|...:.....|....:|||          :.|:::|..  .|.|..||.| |:   :.
plant   223 LTSKEWLPLSLAQARCFRKMKGILVNTVAELEPHALKMFNINGDD--LPQVYPVGPVLHLENGND 285

  Fly   273 PKPLPSDLQKILDNAP-KGVILISWGSQLKACSLSAARRDGIVKAIGRLEQEVIWKYENDTLPNK 336
            .....|::.:.||..| |.|:.:.:|| |...:....|...:  |:.|..|..:|     .|.:.
plant   286 DDEKQSEILRWLDEQPSKSVVFLCFGS-LGGFTEEQTRETAV--ALDRSGQRFLW-----CLRHA 342

  Fly   337 PPNLHIRK---------------------------WLPQRDILAHPNLKVFMSHGGLMGTTEAVS 374
            .||:...:                           |.||..:|..|.:..|::|.|.....|::.
plant   343 SPNIKTDRPRDYTNLEEVLPEGFLERTLDRGKVIGWAPQVAVLEKPAIGGFVTHCGWNSILESLW 407

  Fly   375 SAVPIVGVPIYGDQSLNIAALVQR-GMALQL-----------ELKKLDENTVYEALTKAL--DPS 425
            ..||:|..|:|.:|.:|...:|:. |:|:::           |::.:....:..|:.:.:  |..
plant   408 FGVPMVTWPLYAEQKVNAFEMVEELGLAVEIRKYLKGDLFAGEMETVTAEDIERAIRRVMEQDSD 472

  Fly   426 FKARAKEVA 434
            .:...||:|
plant   473 VRNNVKEMA 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 86/399 (22%)
UGT71B5NP_001328018.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.