DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and AT4G15260

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_193261.2 Gene:AT4G15260 / 827192 AraportID:AT4G15260 Length:359 Species:Arabidopsis thaliana


Alignment Length:245 Identity:51/245 - (20%)
Similarity:87/245 - (35%) Gaps:75/245 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 DNAPKGVILISWGSQLKACSLSAARRDGIVKAIGRLEQEVIWKYENDTLPNKPPNLHIRK----- 344
            |..||.|:.:.:||.   ...:..:...:..|:.|.....:|     :|....||:.:.:     
plant   147 DQPPKSVLFLCFGSM---GGFTEEQTREVAVALNRSGHRFLW-----SLRRASPNIMMERPGDYK 203

  Fly   345 ----------------------WLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGD 387
                                  |.||..:|..|.:..|::|.|.....|::...||:|..|:|.:
plant   204 NLEEVLPDGFLERTLDRGKVIGWAPQVAVLEKPAIGGFVTHCGWNSMLESLWFGVPMVTWPLYAE 268

  Fly   388 QSLNIAALVQRGMALQLELKKL----------DENTVYEALTKAL------DPSFKARAKEVASS 436
            |.:|...:|:. :.|.:|::|.          .|....|.:.:|:      |...::|.||:|..
plant   269 QKVNAFEMVEE-LGLAVEIRKCISGDLLLIGEMEIVTAEDIERAIRCVMEQDSDVRSRVKEMAEK 332

  Fly   437 YNNRIQGPLETAIWWVEHVAETKGAPLTQPSAVHLSRFVYYSLDVYSVVA 486
            .                |||...|.    .|...|.:|:.   ||...||
plant   333 C----------------HVALMDGG----SSKTALQKFIQ---DVIENVA 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 43/217 (20%)
AT4G15260NP_193261.2 Glycosyltransferase_GTB_type <1..359 CDD:299143 49/243 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.