DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and AT4G14090

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_193146.1 Gene:AT4G14090 / 827046 AraportID:AT4G14090 Length:456 Species:Arabidopsis thaliana


Alignment Length:471 Identity:105/471 - (22%)
Similarity:157/471 - (33%) Gaps:145/471 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PPST-------LTDTI--SLEDFERPYSFLFHYVEFFILHKMGREDCNTTLHSRALTEILKNPPG 130
            ||||       .||..  .|:.||....::..      |.:.|         |.||.:|:|    
plant    57 PPSTKGLSFAWFTDGFDDGLKSFEDQKIYMSE------LKRCG---------SNALRDIIK---- 102

  Fly   131 YYDVILLEQFNTDCAMSVAHVFQAPVIGMSSCALMPWHYERFGAPLIPSYISALFQGQSQEMSFA 195
                     .|.|.....     .|:.|:....|:||             :|.:    ::|....
plant   103 ---------ANLDATTET-----EPITGVIYSVLVPW-------------VSTV----AREFHLP 136

  Fly   196 GRLGNWI---TVHSLNLLYKMFTVPAGNALIRQRFG------PGLP--STEDL--------VRNT 241
            ..| .||   ||  |::.|..|     |...:..|.      |.||  :|.||        ...:
plant   137 TTL-LWIEPATV--LDIYYYYF-----NTSYKHLFDVEPIKLPKLPLITTGDLPSFLQPSKALPS 193

  Fly   242 SLMLVNQHFSL----SGPKPLPPN--------VIEVGGVHISPPKPLPS--------------DL 280
            :|:.:.:|...    |.||.|...        :..|..:.:.|..||.|              |.
plant   194 ALVTLREHIEALETESNPKILVNTFSALEHDALTSVEKLKMIPIGPLVSSSEGKTDLFKSSDEDY 258

  Fly   281 QKILDN-APKGVILISWGSQLKACSLSAARRDGIVKAIGRLEQEVIWKYENDTLPNKPPNLHIR- 343
            .|.||: ..:.||.||.|:.  |..|.....:.:...:....:..:|.........|..|..:. 
plant   259 TKWLDSKLERSVIYISLGTH--ADDLPEKHMEALTHGVLATNRPFLWIVREKNPEEKKKNRFLEL 321

  Fly   344 ----------KWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLNIAALVQR 398
                      .|..|..:|||..:..|::|.|...|.|::.|.||:|..|.:.|| ...|.||:.
plant   322 IRGSDRGLVVGWCSQTAVLAHCAVGCFVTHCGWNSTLESLESGVPVVAFPQFADQ-CTTAKLVED 385

  Fly   399 GMALQLELKKLDENTVYEALTKALDPSFKARAKEVASSYNNRIQGPLETAIWW----VEHVAETK 459
            ...:.:::|..:|..|        |.....|..|...|.....:...|.|..|    |:..||  
plant   386 TWRIGVKVKVGEEGDV--------DGEEIRRCLEKVMSGGEEAEEMRENAEKWKAMAVDAAAE-- 440

  Fly   460 GAPLTQPSAVHLSRFV 475
            |.    ||.::|..||
plant   441 GG----PSDLNLKGFV 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 99/454 (22%)
AT4G14090NP_193146.1 YjiC 11..445 CDD:224732 101/462 (22%)
Glycosyltransferase_GTB_type 12..454 CDD:299143 105/471 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.