DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT72E1

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_566938.1 Gene:UGT72E1 / 824238 AraportID:AT3G50740 Length:487 Species:Arabidopsis thaliana


Alignment Length:490 Identity:113/490 - (23%)
Similarity:179/490 - (36%) Gaps:113/490 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LGLFPHPAISHFKFFHPIMR-GLAEAG-HSVDVISPFEDKDPPNGYKDHLLPP---STLTDTISL 85
            :.:|..|.:.|   ..|::. |...|| |..||.....:.|..:.....|..|   :.|.|.:.|
plant     8 VAMFASPGMGH---IIPVIELGKRLAGSHGFDVTIFVLETDAASAQSQFLNSPGCDAALVDIVGL 69

  Fly    86 EDFERPYSFLFHYVEFF--ILHKMGREDCNTTLHSRALTEILKNPPGYYDVILLEQFNTDCAMSV 148
            ...:  .|.|.....||  .|..|.||...|.   |:..|.:::.|   ..::::.|..|.....
plant    70 PTPD--ISGLVDPSAFFGIKLLVMMRETIPTI---RSKIEEMQHKP---TALIVDLFGLDAIPLG 126

  Fly   149 AHVFQAPVIGMSSCALMPWHYERFGAPLIPSYISALFQGQSQE---------------MSFAGRL 198
            ........|.::|.|       ||.|  :..:...|.:...:|               :.|...|
plant   127 GEFNMLTYIFIASNA-------RFLA--VALFFPTLDKDMEEEHIIKKQPMVMPGCEPVRFEDTL 182

  Fly   199 GNWITVHSLNLLYKMFTVPAGNALIRQRFGPGLPSTEDLVRNT-SLMLVNQHFSLSGPKPLPPNV 262
            ..::..:|  .||:.| ||         ||...|:.:.::.|| ..|......||..||.|.   
plant   183 ETFLDPNS--QLYREF-VP---------FGSVFPTCDGIIVNTWDDMEPKTLKSLQDPKLLG--- 232

  Fly   263 IEVGGVHISPPKPL--PSDLQK----ILD----NAPKGVILISWGSQLKACSLSAARRDGIVKAI 317
             .:.||.:.|..||  |.|..|    :||    ...:.|:.||:||   ..||||.:...:...:
plant   233 -RIAGVPVYPIGPLSRPVDPSKTNHPVLDWLNKQPDESVLYISFGS---GGSLSAKQLTELAWGL 293

  Fly   318 GRLEQEVIWKYE-------------------NDTLPNKPP----------NLHIRKWLPQRDILA 353
            ...:|..:|...                   .|..|:..|          ...:..|.||.:|||
plant   294 EMSQQRFVWVVRPPVDGSACSAYLSANSGKIRDGTPDYLPEGFVSRTHERGFMVSSWAPQAEILA 358

  Fly   354 HPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLNIAALVQRGMALQLELKKLDENTV---- 414
            |..:..|::|.|.....|:|...||::..|::.:|.:| |.|:...:.:.:..|||....|    
plant   359 HQAVGGFLTHCGWNSILESVVGGVPMIAWPLFAEQMMN-ATLLNEELGVAVRSKKLPSEGVITRA 422

  Fly   415 -YEALTKALDPSFKARAKEVASSYNNRIQGPLETA 448
             .|||.:      |...:|..:....:|:...|||
plant   423 EIEALVR------KIMVEEEGAEMRKKIKKLKETA 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 113/490 (23%)
UGT72E1NP_566938.1 PLN02992 1..487 CDD:178572 113/490 (23%)
YjiC 5..479 CDD:224732 113/490 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.