DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and AT3G46690

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_190253.1 Gene:AT3G46690 / 823822 AraportID:AT3G46690 Length:452 Species:Arabidopsis thaliana


Alignment Length:262 Identity:70/262 - (26%)
Similarity:113/262 - (43%) Gaps:56/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 FGPGLPSTE---DLV--RNTSLMLVN-----QHFSLSG-PKPLPPNVIEVGGVHISPPKPLPSDL 280
            |||..|..|   ::|  |..|.:::|     :..|||. .:.|...|..:|.:||:...|.||.|
plant   185 FGPLEPLLEMCREVVNKRTASAVIINTASCLESLSLSWLQQELGIPVYPLGPLHITASSPGPSLL 249

  Fly   281 QKILD-------NAPKGVILISWGSQLKACSLSAARRDGIVKAIGRL--EQEVIWKYEN------ 330
            |:.:.       ..|:.||.||.|::     .....::.:..|.|.|  .|..:|....      
plant   250 QEDMSCIEWLNKQKPRSVIYISLGTK-----AHMETKEMLEMAWGLLNSNQPFLWVIRPGSVAGF 309

  Fly   331 ---DTLPNKPPNL-----HIRKWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGD 387
               :.||.:...:     :|.||.||.::|.||.:..|.||.|...|.|::...||::..|:.|:
plant   310 EWIELLPEEVIKMVTERGYIAKWAPQIEVLGHPAVGGFWSHCGWNSTLESIVEGVPMICRPLQGE 374

  Fly   388 QSLN---IAALVQRGMALQLELKK-----------LDENTVYEALTKALD--PSFKARAKEVASS 436
            |.||   |.::.:.|:.|:.|:::           :||... ....:|||  ....|..:...||
plant   375 QKLNAMYIESVWKIGIQLEGEVEREGVERAVKRLIIDEEGA-AMRERALDLKEKLNASVRSGGSS 438

  Fly   437 YN 438
            ||
plant   439 YN 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 70/262 (27%)
AT3G46690NP_190253.1 Glycosyltransferase_GTB_type 1..451 CDD:299143 70/262 (27%)
YjiC 7..431 CDD:224732 65/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.