DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT76E11

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_190251.1 Gene:UGT76E11 / 823820 AraportID:AT3G46670 Length:451 Species:Arabidopsis thaliana


Alignment Length:465 Identity:99/465 - (21%)
Similarity:187/465 - (40%) Gaps:97/465 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PAISHFKFFHPIMRGLAEA----GHSVDVI-SPFEDKDPPNGYKDHLLPPSTLTDTISLEDFE-- 89
            ||..|..   |||: ||:.    |.|:.:. :.|....|.:.:.|...  .|:.:::...|||  
plant    16 PAQGHIS---PIMQ-LAKTLHLKGFSITIAQTKFNYFSPSDDFTDFQF--VTIPESLPESDFEDL 74

  Fly    90 RPYSFLFHYVEFFILHKMGREDCNTTLHSRALTEILKNPPGYYDVILLEQFNTDCAMSVAHVFQA 154
            .|..|         |||:.:| |..:... .|.::|.........::.::| ...|.:.|..|:.
plant    75 GPIEF---------LHKLNKE-CQVSFKD-CLGQLLLQQGNEIACVVYDEF-MYFAEAAAKEFKL 127

  Fly   155 P-VIGMSSCALMPWHYERFGAPLIPSYISALFQGQSQEMSFAGR----------LGNWITVHSLN 208
            | ||..::.|........|......|.::.|.:.:.|:......          :.:|.::.|:.
plant   128 PNVIFSTTSATAFVCRSAFDKLYANSILTPLKEPKGQQNELVPEFHPLRCKDFPVSHWASLESMM 192

  Fly   209 LLYKMFTVPAGNALIRQRFGPGLPSTEDLVRNTSLMLVNQHFSLSGPKPLPPNVIEVGGVHI--S 271
            .||:       |.:.::.....:.:|...:.::||..:.|...:    |:.|    :|.:|:  |
plant   193 ELYR-------NTVDKRTASSVIINTASCLESSSLSRLQQQLQI----PVYP----IGPLHLVAS 242

  Fly   272 PPKPLPSDLQKILD--NAPK--GVILISWGSQLKACSLSAARRDGIVK-AIG--RLEQEVIWKYE 329
            ....|..:.:..::  |..|  .||.:|.|      ||:....:.::: |:|  ..:|:.:|...
plant   243 ASTSLLEENKSCIEWLNKQKKNSVIFVSLG------SLALMEINEVIETALGLDSSKQQFLWVIR 301

  Fly   330 ------NDTLPNKPPNL--------HIRKWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIV 380
                  ::.:.|.|...        :|.||.||:::|:||.:..|.||.|...|.|::...||::
plant   302 PGSVRGSEWIENLPKEFSKIISGRGYIVKWAPQKEVLSHPAVGGFWSHCGWNSTLESIGEGVPMI 366

  Fly   381 GVPIYGDQSLNIAAL-------------VQRGMALQLELKKLDENTVYEALTK---ALDPSFKAR 429
            ..|...||.:|...|             :.|| |::..:::|......|.:.|   :|....:|.
plant   367 CKPFSSDQMVNARYLECVWKIGIQVEGDLDRG-AVERAVRRLMVEEEGEGMRKRAISLKEQLRAS 430

  Fly   430 AKEVASSYNN 439
            .....||:|:
plant   431 VISGGSSHNS 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 99/465 (21%)
UGT76E11NP_190251.1 PLN02410 1..451 CDD:178032 99/465 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.