DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and AT3G22250

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_188864.1 Gene:AT3G22250 / 821795 AraportID:AT3G22250 Length:461 Species:Arabidopsis thaliana


Alignment Length:197 Identity:48/197 - (24%)
Similarity:82/197 - (41%) Gaps:46/197 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 PNVIEVGGVH-------ISPPKPL-----PSDLQKILDNAPKGVILISWGS----------QLKA 302
            |.::.:|.:|       |:..|..     .|.|..:.:..|..||.||:||          |..|
plant   242 PQILHLGPLHNQEATNNITITKTSFWEEDMSCLGWLQEQNPNSVIYISFGSWVSPIGESNIQTLA 306

  Fly   303 CSLSAARRDGIVKAIGRLEQEVIWKYENDTLPNKPPNL-----------HIRKWLPQRDILAHPN 356
            .:|.|:.|. .:.|:.|:.||.:           ||..           .|..|.||.::|.:.:
plant   307 LALEASGRP-FLWALNRVWQEGL-----------PPGFVHRVTITKNQGRIVSWAPQLEVLRNDS 359

  Fly   357 LKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLNIAALVQRGMALQLELKKLDENTVYEALTKA 421
            :..:::|.|...|.|||:|:..::..|:.|||.:|...:|. ...:.:.|....|..|.:.|.|.
plant   360 VGCYVTHCGWNSTMEAVASSRRLLCYPVAGDQFVNCKYIVD-VWKIGVRLSGFGEKEVEDGLRKV 423

  Fly   422 LD 423
            ::
plant   424 ME 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 48/197 (24%)
AT3G22250NP_188864.1 PLN02562 1..461 CDD:215305 48/197 (24%)
YjiC 6..445 CDD:224732 48/197 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.