DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT71B8

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_188817.1 Gene:UGT71B8 / 821734 AraportID:AT3G21800 Length:480 Species:Arabidopsis thaliana


Alignment Length:383 Identity:80/383 - (20%)
Similarity:141/383 - (36%) Gaps:88/383 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VEFFILHKMGREDCNTTLHSRALTEILKNPPGYYDVI-------------------------LLE 138
            :...||..:..:|.:.:.:..||: ...|...:|:||                         |::
plant    36 ISIIILPLLSGDDVSASAYISALS-AASNDRLHYEVISDGDQPTVGLHVDNHIPMVKRTVAKLVD 99

  Fly   139 QF-----NTDCAMSVAHVFQAPVIGMSSCALMP---WHYERFGAPLIPSYISALFQGQSQEMSFA 195
            .:     :...|..|..:|...||.:::...:|   ::....|...:..:|..||..:...:|..
plant   100 DYSRRPDSPRLAGLVVDMFCISVIDVANEVSVPCYLFYTSNVGILALGLHIQMLFDKKEYSVSET 164

  Fly   196 GRLGNWIT--VHSLNLLYKMFTVPAGNALIRQRFGPGLPSTEDLVRNTSLMLVNQ---------- 248
            ....:.:.  |.||...|.:..:|.|  |..:.:.|...:.....|....:|||.          
plant   165 DFEDSEVVLDVPSLTCPYPVKCLPYG--LATKEWLPMYLNQGRRFREMKGILVNTFAELEPYALE 227

  Fly   249 --HFSLSGPKPLPPNVIEVGGV-----HISPPK-PLPSDLQKILD-NAPKGVILISWGSQLKACS 304
              |.|...|:..|     ||.:     |:...| ...||:.:.|| ..||.|:.:.:|| :...:
plant   228 SLHSSGDTPRAYP-----VGPLLHLENHVDGSKDEKGSDILRWLDEQPPKSVVFLCFGS-IGGFN 286

  Fly   305 LSAARRDGIVKAIGRLEQEVIWKYE------NDTLPNKPPNLH----------------IRKWLP 347
            ...||...|  |:.|.....:|...      :..||.:..||.                :..|.|
plant   287 EEQAREMAI--ALERSGHRFLWSLRRASRDIDKELPGEFKNLEEILPEGFFDRTKDKGKVIGWAP 349

  Fly   348 QRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLNIAALVQR-GMALQL 404
            |..:||.|.:..|::|.|.....|::...|||...|:|.:|..|...:|:. |:|:::
plant   350 QVAVLAKPAIGGFVTHCGWNSILESLWFGVPIAPWPLYAEQKFNAFVMVEELGLAVKI 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 80/383 (21%)
UGT71B8NP_188817.1 PLN02554 2..480 CDD:215304 80/383 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.