DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36E1 and UGT71B6

DIOPT Version :9

Sequence 1:NP_609911.1 Gene:Ugt36E1 / 35139 FlyBaseID:FBgn0027070 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_188815.2 Gene:UGT71B6 / 821732 AraportID:AT3G21780 Length:479 Species:Arabidopsis thaliana


Alignment Length:533 Identity:108/533 - (20%)
Similarity:180/533 - (33%) Gaps:168/533 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LGLFPHPAISHFKFFHPIMRGLAEAGHSVDVISPFEDKDPPNGYKDHLLPPSTLTDTISLEDFER 90
            |...|.|||||..             .:|::.....||:            ..|:.|:.:..|..
plant     5 LVFIPSPAISHLM-------------ATVEMAEQLVDKN------------DNLSITVIIISFSS 44

  Fly    91 PYSFLFHYVEFFILHKMGREDCNTTLHSRALTEILKNPPGYYDVIL-LEQFNTDCAMSVAHVF-- 152
            .                     ||::    :|.:..|....|::|. .:|..|:...:.:|:.  
plant    45 K---------------------NTSM----ITSLTSNNRLRYEIISGGDQQPTELKATDSHIQSL 84

  Fly   153 -----------------QAP-----VIGMSSCALMPWHYERFGAPLIPSYISALFQGQSQEMSFA 195
                             .||     |:.| .|..|......||   :|||   ||  .:....|.
plant    85 KPLVRDAVAKLVDSTLPDAPRLAGFVVDM-YCTSMIDVANEFG---VPSY---LF--YTSNAGFL 140

  Fly   196 GRLGNWITVHSLNLLYKMFTVPAGNALIRQRFGPGLPSTEDL----------------------V 238
            |.|.:...::....:|.|..:...:.   :...|.|.|...|                      .
plant   141 GLLLHIQFMYDAEDIYDMSELEDSDV---ELVVPSLTSPYPLKCLPYIFKSKEWLTFFVTQARRF 202

  Fly   239 RNTSLMLVNQ---------HFSLSG--PKPLPPN-VIEVGGVHISPPKPLPSDLQKILD-NAPKG 290
            |.|..:|||.         .|..:|  |:..|.. ::.:..|:........|::.:.|| ..|:.
plant   203 RETKGILVNTVPDLEPQALTFLSNGNIPRAYPVGPLLHLKNVNCDYVDKKQSEILRWLDEQPPRS 267

  Fly   291 VILISWGSQLKACSLSAARRDGIVKAIGRLEQEVIWKYENDTLPN---KPP----NLH------- 341
            |:.:.:|| :...|....|...:  |:.|.....:|.....: ||   :||    ||.       
plant   268 VVFLCFGS-MGGFSEEQVRETAL--ALDRSGHRFLWSLRRAS-PNILREPPGEFTNLEEILPEGF 328

  Fly   342 ---------IRKWLPQRDILAHPNLKVFMSHGGLMGTTEAVSSAVPIVGVPIYGDQSLNIAALVQ 397
                     :..|..|..|||.|.:..|:||||...|.|::...||:...|:|.:|..|...:|:
plant   329 FDRTANRGKVIGWAEQVAILAKPAIGGFVSHGGWNSTLESLWFGVPMAIWPLYAEQKFNAFEMVE 393

  Fly   398 RGMALQLELKK---------LDENTVYEALTKAL------DPSFKARAKEVASSYNNRIQ--GPL 445
            . :.|.:|:||         ..|....|.:.|.:      |...:.|..|::...:..:.  |..
plant   394 E-LGLAVEIKKHWRGDLLLGRSEIVTAEEIEKGIICLMEQDSDVRKRVNEISEKCHVALMDGGSS 457

  Fly   446 ETAI-WWVEHVAE 457
            |||: .:::.|.|
plant   458 ETALKRFIQDVTE 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36E1NP_609911.1 egt 3..460 CDD:223071 108/533 (20%)
UGT71B6NP_188815.2 PLN02554 1..473 CDD:215304 108/533 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.